KEGG   Bacillus subtilis subsp. subtilis 168: BSU00830Help
Entry
BSU00830          CDS       T00010                                 

Gene name
ctsR
Definition
(RefSeq) transcriptional regulator CtsR
  KO
K03708  transcriptional regulator of stress and heat shock response
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU00830 (ctsR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU00830 (ctsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CtsR CtsR_C NdhN
Motif
Other DBs
NCBI-GeneID: 936883
NCBI-ProteinID: NP_387964
Pasteur: BG10145
BSORF: BG10145
UniProt: P37568
Structure
PDB: 

Position
101449..101913
Genome map
AA seq 154 aa AA seqDB search
MGHNISDIIEQYLKRVLDQNGKEILEIKRSEIADKFQCVPSQINYVINTRFTSERGYIVE
SKRGGGGYIRIIKIKMNNEVVLINNIISQINTHLSQAASDDIILRLLEDKVISEREAKMM
VSVMDRSVLHIDLPERDELRARMMKAMLTSLKLK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgggacataatatttctgacatcattgaacaatatttaaaacgagtgttagatcaaaat
ggcaaggaaattttagagattaaacgaagtgaaattgcagataaatttcaatgcgttcct
tcccaaataaattatgtcatcaacaccagatttacaagcgaaagaggatatattgttgag
agcaaacgcgggggcggcggttacatcagaatcattaaaattaaaatgaacaatgaagtt
gtcctgatcaataatataatttctcaaattaatacccatttgtctcaagcagcctctgat
gacattattttaaggctattagaagacaaggtaatttcagaaagagaagcaaaaatgatg
gtcagcgtaatggaccgctcagttttacacattgacttacctgaacgtgatgaattaaga
gcgagaatgatgaaggcaatgctgacttctttaaaattaaaataa

DBGET integrated database retrieval system