KEGG   Bacillus subtilis subsp. subtilis 168: BSU00840Help
Entry
BSU00840          CDS       T00010                                 

Gene name
mcsA
Definition
(RefSeq) hypothetical protein
  KO
K19411  protein arginine kinase activator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BSU00840 (mcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UVR FYVE zf-C2H2_3 OrfB_Zn_ribbon zf-3CxxC
Motif
Other DBs
NCBI-GeneID: 936845
NCBI-ProteinID: NP_387965
Pasteur: BG10146
BSORF: BG10146
UniProt: P37569
Position
101927..102484
Genome map
AA seq 185 aa AA seqDB search
MICQECHERPATFHFTKVVNGEKIEVHICEQCAKENSDSYGISANQGFSIHNLLSGLLNM
DSSFQNAGTQMFSHSEQISACPKCGMTFQQFRKIGRFGCSECYKTFHSNITPILRKVHSG
NTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAHVRDQIRLLEQSLKSTDS
EEEQE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgatttgtcaagagtgccacgagagaccagccacttttcactttacaaaggttgttaac
ggagaaaaaatagaagttcatatttgtgaacaatgtgccaaagaaaatagtgattcatat
ggtataagtgcaaatcagggtttctctattcataatttactttcgggtttactgaacatg
gattcttcatttcaaaatgcaggaactcaaatgttcagtcactcggagcaaatatctgct
tgtccgaaatgcggaatgacttttcagcaattcagaaaaattggccgttttggatgttct
gaatgttacaaaacatttcatagcaacattacaccaatcctacgtaaagtgcacagcgga
aacactgtgcatgcaggtaagataccgaaacgaataggcggcaatcttcatgtcagacgg
cagattgatatgctaaaaaaggaattagaatccttaatccatcaagaagaatttgaaaat
gcagctcatgtaagagatcaaattcgtttattagaacaatcactcaaaagtacagatagt
gaggaggaacaggagtaa

DBGET integrated database retrieval system