KEGG   Bacillus subtilis subsp. subtilis 168: BSU00850Help
Entry
BSU00850          CDS       T00010                                 

Gene name
mcsB
Definition
(RefSeq) ATP:guanido phosphotransferase YacI
  KO
K19405  protein arginine kinase [EC:2.7.14.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU00850 (mcsB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.14  Protein-arginine kinases
    2.7.14.1  protein arginine kinase
     BSU00850 (mcsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-gua_Ptrans
Motif
Other DBs
NCBI-GeneID: 936939
NCBI-ProteinID: NP_387966
Pasteur: BG10147
BSORF: BG10147
UniProt: P37570
Position
102484..103575
Genome map
AA seq 363 aa AA seqDB search
MSLKHFIQDALSSWMKQKGPESDIVLSSRIRLARNFEHIRFPTRYSNEEASSIIQQFEDQ
FSEQEIPGIGKFVLIRMNDAQPLEKRVLVEKHLISPNLTESPFGGCLLSENEEVSVMLNE
EDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGYLTSCPTNVGTGLRASVM
MHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQISNQITLGKSEQDIVEDL
NSVAAQLIEQERSAREAIYQTSKIELEDRVYRSYGVLSNCRMIESKETAKCLSDVRLGID
LGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIRRAALIRERLHLEMNGKRQED
ESI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaaagcattttattcaggacgcactaagcagttggatgaagcagaaaggacct
gaaagtgacattgtactcagcagccgcatacgtttagcaagaaactttgagcatattcgg
ttccctacgcggtattccaatgaagaagcctcatccatcatacagcaatttgaagatcag
ttttcagagcaagaaattcccggaatcggcaaatttgttttgattagaatgaatgatgca
cagcctttagaaaagcgtgtacttgttgaaaaacatctaatcagcccgaatttgacagag
tctccttttggcggctgtttgctttctgaaaatgaggaagtaagcgtcatgctaaatgaa
gaggaccatattagaattcagtgtcttttccctggatttcagcttttagaagcaatgaaa
gccgcaaaccaggtcgacgactggattgaagaaaaagttgattatgcattcaatgagcaa
agaggatacttaaccagctgtcctacaaacgtaggtactggtttaagggcttcggtcatg
atgcatctgccggcgctggttttaactaggcaaataaatcgaattataccggcaattaat
caattaggcttagttgttagaggaatttatggggaaggcagcgaagcagtagggaatatc
tttcaaatttcaaatcagatcacgcttggtaagtcagagcaggatattgtagaggatctt
aacagtgttgctgctcagttgattgaacaagaacgatctgcccgagaagcgatttatcaa
acttctaaaatcgaacttgaggatcgggtatatcggtcatatggggtcttgtctaattgc
cggatgatagaatcgaaagaaactgcaaagtgcctttcagatgttcggttaggcatagac
ttaggcataataaaaggactttcaagcaacatacttaacgaacttatgattttgacgcag
ccagggtttttacagcaatactcgggaggcgctttgcgaccgaacgaaagggacattcga
agagcggctctcatcagagaacggcttcacttagaaatgaatgggaaaagacaggaggat
gaatcgatatga

DBGET integrated database retrieval system