KEGG   Bacillus subtilis subsp. subtilis 168: BSU00860Help
Entry
BSU00860          CDS       T00010                                 

Gene name
clpC
Definition
(RefSeq) negative regulator of genetic competence ClpC/MecB
  KO
K03696  ATP-dependent Clp protease ATP-binding subunit ClpC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU00860 (clpC)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP100
   BSU00860 (clpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 Clp_N ClpB_D2-small AAA AAA_5 Sigma54_activat AAA_16 IstB_IS21 AAA_22 UVR AAA_18 Mg_chelatase AAA_14 TniB AAA_7 DNA_pol3_delta2 Roc RNA_helicase ATPase_2 AAA_3 Zeta_toxin RsgA_GTPase NACHT Sigma54_activ_2 ABC_tran
Motif
Other DBs
NCBI-GeneID: 938481
NCBI-ProteinID: NP_387967
Pasteur: BG10148
BSORF: BG10148
UniProt: P37571
Structure
PDB: 

Position
103572..106004
Genome map
AA seq 810 aa AA seqDB search
MMFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGIAAKALQALGLGSEKI
QKEVESLIGRGQEMSQTIHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA
ARVLNNLGVSLNKARQQVLQLLGSNETGSSAAGTNSNANTPTLDSLARDLTAIAKEDSLD
PVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIINNEVPEILRDKRVM
TLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAIDASNIL
KPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQVDQPSVDESIQILQGLRDRYEA
HHRVSITDDAIEAAVKLSDRYISDRFLPDKAIDLIDEAGSKVRLRSFTTPPNLKELEQKL
DEVRKEKDAAVQSQEFEKAASLRDTEQRLREQVEDTKKSWKEKQGQENSEVTVDDIAMVV
SSWTGVPVSKIAQTETDKLLNMENILHSRVIGQDEAVVAVAKAVRRARAGLKDPKRPIGS
FIFLGPTGVGKTELARALAESIFGDEESMIRIDMSEYMEKHSTSRLVGSPPGYVGYDEGG
QLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVLEDGRLTDSKGRTVDFRNTILIMTSNV
GASELKRNKYVGFNVQDETQNHKDMKDKVMGELKRAFRPEFINRIDEIIVFHSLEKKHLT
EIVSLMSDQLTKRLKEQDLSIELTDAAKAKVAEEGVDLEYGARPLRRAIQKHVEDRLSEE
LLRGNIHKGQHIVLDVEDGEFVVKTTAKTN
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttggaagatttacagaacgagctcaaaaagtactggcgctagcacaggaagaa
gcacttcggttaggtcataataacattggcactgagcatattttattaggactggtaaga
gaaggagagggcattgctgctaaagctcttcaagcgcttggactcggttcagaaaaaatt
cagaaagaagtagaaagtttgatcgggcgcgggcaggaaatgtctcaaacgattcattat
actcctagagctaaaaaagtcattgagctttcaatggatgaggcaagaaaactcggtcat
tcttatgtgggaacagaacatattcttcttggtctgattcgtgaaggagaaggtgttgct
gcgagagttctgaataatctcggtgtcagcttaaataaagcaagacagcaggtgctccag
cttctaggaagtaatgaaacaggatcatcagcggcaggaacaaacagcaatgcgaatacg
cctacgcttgacagcttggcaagagacttaactgctattgcgaaggaagacagccttgac
cctgtaatcggcagaagcaaggagatccagcgtgtcattgaagtgttaagccgcagaacg
aaaaacaaccctgttctcattggggaaccaggtgtaggtaaaacggctatcgcagaaggt
ttggcacagcaaattatcaataatgaagtacccgaaattttgcgtgataaacgtgtgatg
acattagacatgggaacagttgttgccggcacaaaataccgcggagaatttgaggatcgc
ctgaagaaggtcatggatgaaattcgccaggcaggaaatatcattctattcatcgatgag
ctccatacattaatcggggcaggcggagcagaaggtgctattgatgcatctaatatttta
aaaccttcacttgctcgtggcgaactccaatgtattggtgcaacgactcttgatgagtac
cgtaaatatattgaaaaagatgcagcactggaacgccgttttcagccgattcaggttgat
cagccatctgtagatgaaagtattcaaattttacaaggtctgcgtgacagatacgaagcc
caccaccgcgtttctatcactgatgatgccattgaagctgcggttaagctttctgacaga
tatatttctgaccgcttccttccggataaagcaattgacttgatcgatgaagcgggttca
aaggtgagactgcgctcatttacaacgcctcctaacttaaaagagcttgagcagaagctt
gatgaggttcgtaaagagaaggatgcggcagtgcaaagccaagagtttgaaaaagctgct
tccttgcgtgatactgaacaacgcctgcgcgagcaagtagaggatacgaagaaatcatgg
aaagagaagcaagggcaggaaaactcagaggttactgtggatgatattgcgatggttgta
tccagctggaccggtgtgcctgtatctaaaatcgcccaaactgaaactgataagcttctc
aatatggaaaacattcttcactcccgtgtcatcggccaggatgaagcagttgtagcggtt
gcaaaagccgtcagacgtgcaagagcaggattgaaagatcctaaacgcccaatcggctca
ttcattttcttaggccctacaggtgtaggtaaaacagaacttgcacgagcacttgctgaa
tccatttttggcgatgaagaatccatgatcagaattgatatgtctgaatacatggaaaaa
cattcaacttcaagacttgttggttcacctccgggttatgtgggatatgatgaaggcggt
caattgacagagaaagtcagaagaaaaccttactctgtcgtgcttcttgatgagatcgag
aaagcgcaccctgatgtcttcaatatccttctgcaagttcttgaagacggacgattgact
gattctaaaggacgcacagtcgatttccgcaataccattctgatcatgacatcaaacgtc
ggagcaagtgagctaaaacgcaataaatatgtcggctttaacgttcaggatgaaactcaa
aatcataaagacatgaaagataaagtgatgggtgaattaaaacgagcgttcagacctgag
ttcatcaaccgtattgatgaaatcattgtcttccattcacttgagaaaaaacatctcact
gagattgtgtcattaatgtctgatcaattaacgaaacgcctgaaagaacaagatctttct
atcgaattgacagatgctgcaaaagcgaaagtcgcggaagagggcgttgacctggaatac
ggtgcccgtccgttaagaagagcgatccaaaaacatgtcgaggatcgtttatctgaagaa
ctcctcagaggaaatattcataaaggacagcatattgttcttgatgtagaagatggcgaa
tttgtcgtaaaaacgactgctaaaacgaattaa

DBGET integrated database retrieval system