KEGG   Bacillus subtilis subsp. subtilis 168: BSU00870
Entry
BSU00870          CDS       T00010                                 
Symbol
radA
Name
(RefSeq) DNA repair protein RadA
  KO
K04485  DNA repair protein RadA/Sms
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU00870 (radA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BSU00870 (radA)
SSDB
Motif
Pfam: AAA_25 ATPase Rubredoxin_2 ChlI Rad51 DnaB_C Lon_C AAA_22 AAA_16 AAA_24 AAA RecA AAA_14 ABC_tran NTPase_1 GvpD_P-loop DUF2075 AAA_5 AAA_30 NACHT ATPase_2 KTI12 MCM divDNAB HypA Zeta_toxin Isochorismatase
Other DBs
NCBI-GeneID: 936872
NCBI-ProteinID: NP_387968
Pasteur: BG10149
BSORF: BG10149
UniProt: P37572 A0A6M4JEY3
Position
106096..107472
AA seq 458 aa
MAKTKSKFICQSCGYESPKWMGKCPGCGAWNTMVEEMIKKAPANRRAAFSHSVQTVQKPS
PITSIETSEEPRVKTQLGEFNRVLGGGVVKGSLVLIGGDPGIGKSTLLLQVSAQLSGSSN
SVLYISGEESVKQTKLRADRLGINNPSLHVLSETDMEYISSAIQEMNPSFVVVDSIQTVY
QSDITSAPGSVSQVRECTAELMKIAKTKGIPIFIVGHVTKEGSIAGPRLLEHMVDTVLYF
EGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPSEIFLEERSAGSAGSSITAS
MEGTRPILVEIQALISPTSFGNPRRMATGIDHNRVSLLMAVLEKRVGLLLQNQDAYLKVA
GGVKLDEPAIDLAIVISIASSFRDTPPNPADCFIGEVGLTGEVRRVSRIEQRVKEAAKLG
FKRMIIPAANLDGWTKPKGIEVIGVANVAEALRTSLGG
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggctaaaacaaaatcgaagttcatctgccaatcctgcggctacgagtctccaaaatgg
atggggaaatgtccgggctgtggtgcttggaatacaatggtggaagaaatgattaaaaaa
gcaccggccaatcggagagcggctttttctcattctgttcaaactgtacagaaaccttca
cctattacatcaatcgaaacatcagaagaaccccgcgtcaaaacccagcttggcgagttt
aacagagtactcggcggaggtgtcgttaaaggctccctcgttttaattggcggtgatcct
ggtatcggaaagtcaacgctattactgcaggtttccgctcaattatcaggctcatcaaac
agtgtcctgtatatttcgggagaagaatctgtaaagcaaacgaagctgcgagcagaccgt
ctcggcattaataatccgtcactgcatgttttatctgaaaccgatatggagtatatttcg
tctgctatacaagagatgaatccatcgtttgtcgttgttgactctattcaaacggtttac
caaagcgatattacatctgctccaggcagtgtgtcacaggtcagagaatgtaccgctgag
ctgatgaaaattgcaaaaacaaaaggtattccgatttttatcgtagggcacgtgacgaaa
gaagggtctattgcaggtccgagactgttggagcatatggttgacactgttttatatttt
gaaggagaacgccaccatactttccgtattttgcgggctgtaaaaaaccgtttcggatct
acaaacgaaatgggcattttcgaaatgcgggaagaggggctcactgaggttttgaatcct
tcggaaattttcttagaagaacgctctgctggttccgcaggctcgagtatcactgcctct
atggagggcactagaccgattctcgttgaaattcaggcactcatctcgccaacaagtttt
ggcaacccaaggcgtatggcaacgggaatagaccataacagggtttctctgttaatggct
gtgttagaaaaaagagttggactgctgctgcaaaatcaggatgcttatttgaaagtggct
ggcggcgttaagcttgatgaaccggcaattgatcttgcgattgtgattagtattgcatca
agctttagagacacacctccaaatcctgcagattgttttattggagaagtgggattaacc
ggagaagtccggcgggtttcaagaattgaacagcgtgtgaaagaagcggcaaagcttggt
tttaaacgcatgatcatacccgcggcaaatctggatggatggacaaaaccaaaagggatt
gaggttatcggagtagcaaatgttgcagaagcgcttcgtacttcattaggaggataa

DBGET integrated database retrieval system