KEGG   Bacillus subtilis subsp. subtilis 168: BSU00880
Entry
BSU00880          CDS       T00010                                 
Symbol
yacK
Name
(RefSeq) DNA integrity scanning protein DisA
  KO
K07067  diadenylate cyclase [EC:2.7.7.85]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU00880 (yacK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.85  diadenylate cyclase
     BSU00880 (yacK)
SSDB
Motif
Pfam: DisA-linker DAC HHH_2 HHH HHH_5 HHH_3 CRS1_YhbY
Other DBs
NCBI-GeneID: 936868
NCBI-ProteinID: NP_387969
Pasteur: BG10150
BSORF: BG10150
UniProt: P37573 A0A6M3Z6M0
Position
107476..108558
AA seq 360 aa
MEKEKKGAKHELDLSSILQFVAPGTPLRAGMENVLRANTGGLIVVGYNDKVKEVVDGGFH
INTAFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPDATISSSETGMRHRTAERVAKQ
TGCLVIAISERRNVITLYQENMKYTLKDIGFILTKANQAIQTLEKYKTILDKTINALNAL
EFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLIKLQVIELITDMEEEAALF
IKDYVKEKIKDPFVLLKELQDMSSYDLLDDSIVYKLLGYPASTNLDDYVLPRGYRLLNKI
PRLPMPIVENVVEAFGVLPRIIEASAEELDEVEGIGEVRAQKIKKGLKRLQEKHYLDRQL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaaaaagagaaaaaaggggcgaaacacgagttagacctgtcatctatattgcagttt
gttgctccgggtacaccgctcagagcggggatggaaaacgtcttgagagcaaatacaggc
ggtctgattgttgttggatataatgataaagtaaaagaagtggtggacggcggctttcac
ataaacacggctttttctccggcgcatttatatgagctggctaaaatggatggagcgatc
attttaagtgattctggtcaaaagatcctatacgcgaatactcagctgatgccggatgcc
acaatttcttcatcagaaacaggaatgcggcacagaactgccgaaagagtagctaagcaa
actggctgtcttgtaatcgccatttctgaaagaagaaatgtcataacgttatatcaggaa
aacatgaagtatacactaaaagacataggatttattttaaccaaggcgaaccaagccatt
caaacacttgaaaaatataagacaatcctcgataaaacgattaatgcactgaacgcgtta
gagtttgaggaacttgttaccttcagtgatgtcttgtctgtcatgcatcgttatgaaatg
gtactgagaatcaaaaacgaaattaatatgtatatcaaagagctggggacagaagggcat
ctgatcaaactgcaagtcattgaattgattacggatatggaagaagaggccgctttattt
attaaggactatgtaaaagaaaagattaaagatccgtttgttctcttgaaggagctgcag
gatatgtccagttatgatctgctggatgattccattgtgtataagcttctcggttaccct
gcttctactaatcttgatgattatgtattgccgagaggatacaggctgttaaataagata
ccgcgtcttccgatgccgattgttgaaaatgttgtagaagcatttggagtcctgccaagg
attattgaggcgagtgcagaagaattagatgaagtagagggaatcggtgaagtacgagcc
caaaaaatcaaaaaaggattaaaacgcctgcaagagaagcattatttagacagacaactg
tga

DBGET integrated database retrieval system