KEGG   Bacillus subtilis subsp. subtilis 168: BSU00890
Entry
BSU00890          CDS       T00010                                 
Symbol
yacL
Name
(RefSeq) PIN and TRAM-domain containing protein YacL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TRAM PIN_4 Colicin_V PIN_9 PHO4
Other DBs
NCBI-GeneID: 936863
NCBI-ProteinID: NP_387970
Pasteur: BG10151
BSORF: BG10151
UniProt: Q06754 A0A6M4JJ92
Position
108674..109774
AA seq 366 aa
MLKRIVQAFFIIFGGVVGIFLIPELFVLLNIQDIPLITNAYTSAAIGAIIFFLISIWGTE
YVVNWVKWIEDSLLKAPVPDLLFGSLGLVFGLIIAYLIVNVIPLDNIPYRIFSTIIPVFL
AFFLGYLGFQVGFKKKDELISLFSISARMQKKKGTADEEHEVQDKKLKILDTSVIIDGRI
ADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGLDILNRIQKELDIEVEIYE
GDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVAVLNINDLANAVKPVVLPGE
EMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHIDVLVTSVLQTAAGRMIFAKPK
LLEKAL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgttaaaacgaatagttcaggcgttcttcattatttttggcggcgttgttggtatattt
ttgatacctgaattgtttgtactgttaaatatacaggacatacctttaataacaaacgca
tatacgtctgcggcaataggagcaattatcttttttctcatcagtatatggggtacagaa
tacgttgtgaactgggtgaagtggatagaggattcattgttaaaagcgccggttccagat
ttgttatttggaagtcttggcttagtttttggacttataattgcttatcttatcgtaaat
gttattcctttagacaatataccttaccgcatattcagcacaataattcctgtatttttg
gctttcttcctcggttatctcggcttccaggtgggctttaagaaaaaggatgaattgatc
agcctgttttccatttccgccagaatgcaaaagaaaaaaggaacagctgatgaagaacat
gaggttcaagacaagaagctgaaaattttggacactagtgttattattgatgggagaata
gcagatatttgtcagactggttttttagagggagttatcgtgattccgcagtttgtcctt
gaggaattgcagcatattgcagactcttcagatgttttaaaacgaaacagaggacgccgc
ggtcttgatatcctgaaccgcattcagaaagaattagacattgaagttgaaatttacgaa
ggcgactttgaagatattcaggaggttgacagcaagctcgtcaaacttgctaagctgaca
tccggggtcgttgtgacgaatgattttaatttaaataaagtgtgcgagcttcagaaggta
gcagtattaaacattaatgaccttgccaatgcggttaagcctgttgtgcttcctggcgag
gaaatgaatgttcaggtcattaaggacgggaaagagcataatcagggagttgcctacttg
gatgacggtacgatgattgtcgttgaagaaggacggaattatatcggcaagcatattgat
gtactcgtcacaagtgtgctgcagacagcagcgggacgaatgatttttgcgaagcctaag
ctgttggagaaggcgctgtaa

DBGET integrated database retrieval system