KEGG   Bacillus subtilis subsp. subtilis 168: BSU00930
Entry
BSU00930          CDS       T00010                                 

Symbol
cysE
Name
(RefSeq) serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00270  Cysteine and methionine metabolism
bsu00920  Sulfur metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU00930 (cysE)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSU00930 (cysE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     BSU00930 (cysE)
SSDB
Motif
Pfam: Hexapep SATase_N Hexapep_2 DUF2097
Other DBs
NCBI-GeneID: 936831
NCBI-ProteinID: NP_387974
Pasteur: BG10155
BSORF: BG10155
UniProt: Q06750 A0A6M3Z6U9
Position
112800..113453
AA seq 217 aa
MFFRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHALYKRKFYFLARLISQV
SRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQGVTLGGTGKEKGKRHPT
IKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVGIPGRVVVQNGKKVRRDL
NHQDLPDPVADRFKSLEQQILELKAELEDRKERINQK
NT seq 654 nt   +upstreamnt  +downstreamnt
gtgttttttagaatgctcaaagaagacattgatactgtgttcgatcaagatcccgcagca
agaagctattttgaagtgattttaacttattccggtttacatgctatatgggcgcatcgg
attgcacatgctttatataaacgaaaattttatttccttgcacgccttatatctcaagta
agccgattttttaccgggatagaaatccaccccggcgctacaatcgggagaagatttttc
atagaccacggcatgggggttgtcattggggagacatgtgaaatcggcaataacgtaacc
gtttttcagggggttaccctcgggggaacgggaaaagaaaagggaaaaaggcacccaacg
attaaagatgacgcattgatagccacaggtgctaaagtgctcggttctattacggtcggt
gaaggctcaaagattggcgctggttcagtagtgctgcatgatgttcctgatttttcaaca
gttgtcggtatccctggacgggtcgttgtacaaaatggcaagaaagtaagacgcgattta
aaccatcaggatttgcccgatccagttgctgaccgctttaagtctttggaacagcagatt
ttagagctgaaggcagaacttgaagacagaaaagaaaggatcaatcaaaaatga

DBGET integrated database retrieval system