KEGG   Bacillus subtilis subsp. subtilis 168: BSU00950
Entry
BSU00950          CDS       T00010                                 
Symbol
mrnC
Name
(RefSeq) mini-ribonuclease 3
  KO
K11145  mini-ribonuclease III [EC:3.1.26.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU00950 (mrnC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-
     BSU00950 (mrnC)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA processing factors
   BSU00950 (mrnC)
SSDB
Motif
Pfam: Ribonuclease_3 Ribonucleas_3_3 Ribosomal_L27_C Mycovirus_RNAse NinE
Other DBs
NCBI-GeneID: 936369
NCBI-ProteinID: NP_387976
Pasteur: BG12702
BSORF: BG12702
UniProt: O31418 A0A6M3Z756
Structure
Position
114854..115285
AA seq 143 aa
MLEFDTIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFTKPNDLHKKSSRIVSAKSQAE
ILFFLQNQSFFTEEEEAVLKRGRNAKSGTTPKNTDVQTYRYSTAFEALLGYLFLEKKEER
LSQLVAEAIQFGTSGRKTNESAT
NT seq 432 nt   +upstreamnt  +downstreamnt
atgcttgaatttgatacgataaaagattctaagcagcttaacggtcttgcgcttgcttat
ataggtgatgccatttttgaagtgtatgtcaggcatcacctgcttaagcagggctttacc
aaaccaaatgatcttcataagaaatcaagccggattgtttcagcaaagtcacaggctgag
atcctattttttctgcagaatcaatcattttttacggaagaagaggaagcggtgctgaaa
agaggcagaaatgccaagtcagggacaacacctaaaaatacagatgttcagacgtaccgc
tacagtacagcatttgaagcgcttctgggctacctttttctagagaaaaaagaggaacga
cttagtcagctcgtagccgaagctatacaattcgggacgtcagggaggaaaacaaatgag
tcagcaacatga

DBGET integrated database retrieval system