KEGG   Bacillus subtilis subsp. subtilis 168: BSU00960
Entry
BSU00960          CDS       T00010                                 
Symbol
rlmB
Name
(RefSeq) 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB
  KO
K03218  23S rRNA (guanosine2251-2'-O)-methyltransferase [EC:2.1.1.185]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU00960 (rlmB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.185  23S rRNA (guanosine2251-2'-O)-methyltransferase
     BSU00960 (rlmB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU00960 (rlmB)
SSDB
Motif
Pfam: SpoU_methylase SpoU_sub_bind
Other DBs
NCBI-GeneID: 936861
NCBI-ProteinID: NP_387977
Pasteur: BG10157
BSORF: BG10157
UniProt: Q06753 A0A6M3Z761
Position
115269..116018
AA seq 249 aa
MSQQHDYVIGKNAVIETLKSDRKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKKL
DQMVTGQHQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDELEDPHNLGSIMRTADA
VGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDASA
REDFRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMYEV
YRKRNPVGE
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagtcagcaacatgattacgtcatagggaaaaatgcagtgatcgagacgttaaaatct
gatcggaagctgtataagctgtggatggcggaaaacaccgtaaagggacaagcacagcaa
gtgattgagcttgccaaaaagcagggaatcacgattcaatacgtcccgagaaaaaaactc
gatcaaatggtgacaggacagcatcagggcgtagtggcacaggttgcagcgtatgaatat
gcagaactggacgatttatataaagcagccgaagaaaaaaatgaacagcctttcttcctc
attctggacgagcttgaagaccctcataatcttggttccattatgaggacagcagatgcg
gtcggcgctcatggcatcgtcattccaaaacggagagctgtcgggctgacaacaacagtg
gcaaaagcttcaacaggagcaattgagcacattcctgtagcaagagtcaccaatttggca
cggacgttagaagagatgaaagagcggggaatctgggttgtcggaacggatgcgtccgcg
cgtgaggatttccgtaatatggacggcaatatgcctttggctctagtcatcggaagtgaa
ggaaaagggatgggccgccttgtgaaggaaaagtgcgattttctcattaaactcccgatg
gccggaaaggtaacttcactaaatgcatctgtcgcggctggtcttttgatgtatgaagtc
taccggaaacgaaaccctgtgggagaataa

DBGET integrated database retrieval system