KEGG   Bacillus subtilis subsp. subtilis 168: BSU00970
Entry
BSU00970          CDS       T00010                                 
Symbol
yacP
Name
(RefSeq) hypothetical protein
  KO
K06962  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU00970 (yacP)
SSDB
Motif
Pfam: NYN_YacP Phage_GPO Ssu72 ApoLp-III Glyco_hydro_44 DUF4041
Other DBs
NCBI-GeneID: 936993
NCBI-ProteinID: NP_387978
Pasteur: BG10158
BSORF: BG10158
UniProt: P37574 A0A6M3Z6M2
Structure
Position
116025..116537
AA seq 170 aa
MDILLVDGYNMIGAWPQLKDLKANSFEEARDVLIQKMAEYQSYTGNRVIVVFDAHLVKGL
EKKQTNHRVEVIFTKENETADERIEKLAQALNNIATQIHVATSDYTEQWAIFGQGALRKS
ARELLREVETIERRIERRVRKITSEKPAGKIALSEEVLKTFEKWRRGDLD
NT seq 513 nt   +upstreamnt  +downstreamnt
atggatatcctgttagtagacgggtacaacatgattggagcctggccgcagctgaaggat
ttaaaagcgaacagttttgaagaggcgagagacgtactgattcagaaaatggcggaatat
caatcgtatacaggaaacagggttattgttgtttttgacgcgcatctcgtaaaagggctt
gagaaaaaacagaccaaccatagagttgaagtaatttttacaaaagaaaatgagacggct
gatgagcggatagaaaagctcgctcaggctttgaataatattgcgactcaaattcacgtt
gcgacctctgactatactgagcagtgggcgattttcggacagggggcattgcggaaatcg
gcccgggagcttctgagagaggtagaaacgattgaaaggcgaatagagagacgggtaaga
aaaatcacttccgaaaagccggcgggtaaaattgctttatcggaagaggttttgaaaacg
tttgaaaagtggaggcggggagacttagattaa

DBGET integrated database retrieval system