KEGG   Bacillus subtilis subsp. subtilis 168: BSU00980
Entry
BSU00980          CDS       T00010                                 

Symbol
sigH
Name
(RefSeq) RNA polymerase sigma-H factor
  KO
K03091  RNA polymerase sporulation-specific sigma factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU00980 (sigH)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU00980 (sigH)
SSDB
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 GerE HTH_23 HTH_16 HTH_38 Sigma70_ECF Lebercilin HTH_Tnp_Tc3_1 Sigma70_r4 UPF0122
Other DBs
NCBI-GeneID: 936150
NCBI-ProteinID: NP_387979
Pasteur: BG10159
BSORF: BG10159
UniProt: P17869 A0A6M4JCD8
Position
116600..117256
AA seq 218 aa
MNLQNNKGKFNKEQFCQLEDEQVIEKVHVGDSDALDYLITKYRNFVRAKARSYFLIGADR
EDIVQEGMIGLYKSIRDFKEDKLTSFKAFAELCITRQIITAIKTATRQKHIPLNSYASLD
KPIFDEESDRTLLDVISGAKTLNPEEMIINQEEFDDIEMKMGELLSDLERKVLVLYLDGR
SYQEISDELNRHVKSIDNALQRVKRKLEKYLEIREISL
NT seq 657 nt   +upstreamnt  +downstreamnt
gtgaatctacagaacaacaagggaaaattcaacaaagagcagttttgccagttggaggac
gagcaggtcattgaaaaggttcatgttggggacagtgatgcgttagattacttgattacg
aagtaccgaaactttgttcgggcaaaagcaagatcctatttcttaataggggcggacaga
gaggatattgttcaggaaggcatgataggcctctataagtctattcgtgacttcaaagag
gacaagcttacctcattcaaagcttttgcagaattatgtattacccgccaaattattacc
gcaataaagacagctactcgccagaaacacattcctttgaattcctacgcctcattagat
aaaccgatctttgatgaagaatcagaccgaacgctgctggatgtcatttcaggagcgaaa
accttaaatcctgaggaaatgatcattaatcaggaagaatttgatgatattgaaatgaaa
atgggagaactattaagtgatttagagagaaaagtactcgtcttatatctcgacgggaga
agttaccaagagatttctgatgaactgaaccgacatgtgaaatcgatcgacaatgccctt
cagcgtgtgaaacgcaagctggagaagtacttggaaattcgcgaaatcagtttgtaa

DBGET integrated database retrieval system