KEGG   Bacillus subtilis subsp. subtilis 168: BSU01010
Entry
BSU01010          CDS       T00010                                 
Symbol
nusG
Name
(RefSeq) transcription termination/antitermination protein NusG
  KO
K02601  transcription termination/antitermination protein NusG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU01010 (nusG)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU01010 (nusG)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BSU01010 (nusG)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA transcription factors
   BSU01010 (nusG)
SSDB
Motif
Pfam: NusG KOW SH3_4
Other DBs
NCBI-GeneID: 936851
NCBI-ProteinID: NP_387982
Pasteur: BG10162
BSORF: BG10162
UniProt: Q06795 A0A6M3Z6I6
Position
117890..118423
AA seq 177 aa
MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEETDIKNGKKKVVKKKV
FPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPGEAETILKRMGMDERKT
DIDFELKETVKVIDGPFANFTGSIEEIDYDKSKVKVFVNMFGRETPVELEFTQIDKL
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaaaagaattggtatgttgttcacacgtactctggttatgagaataaagtaaaagcc
aacttggaaaagcgtgttgaatcaatggggatgcaggataaaattttccgtgtagtcgta
cccgaagaagaagaaacggatatcaaaaacggcaagaaaaaagtcgtgaaaaagaaagta
ttccctggttatgtgcttgttgaaattgtaatgacagacgactcttggtatgtcgtccgc
aacacgccgggcgttactggattcgtaggatctgccgggtcaggttcaaaaccgacgccg
cttcttccgggggaagcagaaaccattctgaagagaatgggcatggatgaacgaaaaact
gatattgactttgaactgaaagagacagtgaaagtaatagacggaccttttgctaacttt
acaggatcaattgaagagattgattatgataaaagcaaggtcaaagttttcgttaatatg
tttggccgtgaaacgccggttgagctggaatttacccaaatcgataaattgtaa

DBGET integrated database retrieval system