KEGG   Bacillus subtilis subsp. subtilis 168: BSU01020
Entry
BSU01020          CDS       T00010                                 

Gene name
rplK
Definition
(RefSeq) 50S ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01020 (rplK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01020 (rplK)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01020 (rplK)
  Bacteria
    BSU01020 (rplK)
  Archaea
    BSU01020 (rplK)
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Other DBs
NCBI-GeneID: 936838
NCBI-ProteinID: NP_387983
Pasteur: BG10163
BSORF: BG10163
UniProt: Q06796
Structure
PDB: 
3J3W 3J3V

Position
118591..119016
AA seq 141 aa
MAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVEISV
YEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVREIAETKMPDLNAAD
VEAAMRMVEGTARSMGIVIED
NT seq 426 nt   +upstreamnt  +downstreamnt
gtggctaaaaaagtagttaaagttgtaaaattgcaaattcctgctggaaaagctaaccca
gcaccaccagttggacctgcacttggtcaagccggtgttaacatcatgggattctgtaag
gagtttaacgctcgtacagctgaccaagctggtttaatcattcctgttgaaatttcggtt
tacgaagaccgttcatttacatttattacaaaaactccacctgctgcagtattgcttaaa
aaagcagctggaattgagtctggttctggtgaaccaaaccgtaataaagtggcaaccgtt
aagcgcgataaagtacgcgaaatcgctgaaacgaaaatgcctgacttaaacgcagcagac
gttgaagcggcaatgcgcatggttgaaggtactgcccgcagtatgggtattgtaatcgag
gattaa

DBGET integrated database retrieval system