KEGG   Bacillus subtilis subsp. subtilis 168: BSU01030
Entry
BSU01030          CDS       T00010                                 

Gene name
rplA
Definition
(RefSeq) 50S ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01030 (rplA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01030 (rplA)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01030 (rplA)
  Bacteria
    BSU01030 (rplA)
  Archaea
    BSU01030 (rplA)
SSDB
Motif
Pfam: Ribosomal_L1 SHD1 PrlF_antitoxin
Other DBs
NCBI-GeneID: 936843
NCBI-ProteinID: NP_387984
Pasteur: BG10164
BSORF: BG10164
UniProt: Q06797
Structure
PDB: 
3J3W 3J3V

Position
119111..119809
AA seq 232 aa
MAKKGKKYVEAAKLVDRSKAYDVSEAVALVKKTNTAKFDATVEVAFRLGVDPRKNDQQIR
GAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDTDYINKIQQGWFDFDVIVATPDM
MGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEYRVDKAGNIHVPIGKVSF
EDEKLVENFTTMYDTILKAKPAAAKGVYVKNVAVTSTMGPGVKVDSSTFNVK
NT seq 699 nt   +upstreamnt  +downstreamnt
atggctaaaaaaggtaaaaagtacgttgaagctgctaagcttgtagaccgttctaaagct
tacgacgtctctgaagcagtagctctcgttaaaaaaacaaacacagctaaattcgacgct
acagttgaagtggctttccgtttaggggttgaccctcgtaaaaacgaccagcaaatccgt
ggagcagttgtgcttccaaacggaactggtaaaactcagcgcgttctcgttttcgcaaaa
ggcgaaaaagcgaaagaagctgaagctgctggtgcagatttcgtaggcgatactgactac
atcaacaaaattcaacaaggctggttcgatttcgatgttatcgtagctacacctgacatg
atgggtgaagttggtaaaatcggtcgtgtacttggaccaaaaggtttaatgccgaaccct
aaaactggtacagttactttcgaagttgaaaaagctatcggcgaaatcaaagctggtaaa
gttgaataccgcgttgataaagctggaaacattcatgttcctatcggtaaagtttctttc
gaggatgaaaaacttgttgagaacttcacaacaatgtacgatacaatccttaaagctaaa
cctgctgcagctaaaggcgtttacgtgaaaaacgttgctgtaacttctactatgggacct
ggtgtcaaagtagactcttcaacttttaacgtaaaataa

DBGET integrated database retrieval system