KEGG   Bacillus subtilis subsp. subtilis 168: BSU01040
Entry
BSU01040          CDS       T00010                                 

Gene name
rplJ
Definition
(RefSeq) 50S ribosomal protein L10
  KO
K02864  large subunit ribosomal protein L10
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01040 (rplJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01040 (rplJ)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01040 (rplJ)
  Bacteria
    BSU01040 (rplJ)
  Archaea
    BSU01040 (rplJ)
SSDB
Motif
Pfam: Ribosomal_L10 DUF1515
Other DBs
NCBI-GeneID: 936153
NCBI-ProteinID: NP_387985
Pasteur: BG11220
BSORF: BG11220
UniProt: P42923
Position
120061..120561
AA seq 166 aa
MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMT
RRAVEQAELNGLNDFLTGPNAIAFSTEDVVAPAKVLNDFAKNHEALEIKAGVIEGKVSTV
EEVKALAELPSREGLLSMLLSVLQAPVRNLALAAKAVAEQKEEQGA
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcagcgcaattgaaacaaaaaaagttgttgttgaagaaattgcttctaaactgaaa
gaaagtaaatcaacgatcatcgttgactatcgcggacttaacgtttctgaagtaactgaa
cttcgtaaacagcttcgcgaagctaacgttgagttcaaagtttacaaaaatacgatgact
cgccgtgcggttgaacaagctgagcttaatggtttgaatgatttcttaactggaccgaac
gcgatcgcattcagcactgaagatgttgtcgctccggctaaagttcttaatgacttcgct
aaaaatcacgaagctcttgaaatcaaagctggcgttatcgaaggtaaagtttctactgtt
gaagaagtgaaagctcttgctgaacttccatcacgcgaaggcttgctttctatgttgctt
agcgtacttcaagctccagttcgcaaccttgctcttgctgcaaaagctgtggcagaacaa
aaggaagaacaaggcgcttaa

DBGET integrated database retrieval system