KEGG   Bacillus subtilis subsp. subtilis 168: BSU01050
Entry
BSU01050          CDS       T00010                                 

Gene name
rplL
Definition
(RefSeq) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01050 (rplL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01050 (rplL)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01050 (rplL)
  Bacteria
    BSU01050 (rplL)
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N
Other DBs
NCBI-GeneID: 935952
NCBI-ProteinID: NP_387986
Pasteur: BG10726
BSORF: BG10726
UniProt: P02394
Position
120607..120978
AA seq 123 aa
MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAGGAAAGGAAEEQSEFDLI
LAGAGSQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGASV
EVK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggctttaaatatcgaagaaatcattgcttccgttaaagaagcaactgtacttgaattg
aacgacctagtaaaagcaatcgaagaagaatttggcgtaactgctgctgctcctgtagct
gtagctggcggagctgctgctggcggagctgctgaagagcaaagcgaattcgatcttatc
cttgctggtgcaggatctcaaaaaatcaaagttatcaaagttgtacgtgaaatcactggt
cttggcttgaaagaagctaaagagcttgttgacaacactccaaaaccacttaaagaaggt
attgctaaagaagaagctgaagagcttaaagctaaacttgaagaagttggcgcttctgta
gaagttaagtaa

DBGET integrated database retrieval system