KEGG   Bacillus subtilis subsp. subtilis 168: BSU01060
Entry
BSU01060          CDS       T00010                                 

Symbol
ybxB
Name
(RefSeq) hypothetical protein
  KO
K00564  16S rRNA (guanine1207-N2)-methyltransferase [EC:2.1.1.172]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU01060 (ybxB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.172  16S rRNA (guanine1207-N2)-methyltransferase
     BSU01060 (ybxB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BSU01060 (ybxB)
SSDB
Motif
Pfam: MTS Methyltransf_31 Methyltransf_25 PrmA Methyltransf_4 Methyltransf_11 Methyltransf_12 tRNA_U5-meth_tr Methyltransf_18 Ubie_methyltran Met_10 DUF43 Methyltransf_23 UPF0020 GidB Methyltransf_16 Methyltransf_32 Methyltransf_15 PCMT SPOUT_MTase_2 TehB
Other DBs
NCBI-GeneID: 938465
NCBI-ProteinID: NP_387987
Pasteur: BG10727
BSORF: BG10727
UniProt: P37872 A0A6M4JEC3
Position
121068..121673
AA seq 201 aa
MSEHYYSEKPSVKSNKQTWSFRLRNKDFTFTSDSGVFSKKEVDFGSRLLIDSFEEPEVEG
GILDVGCGYGPIGLSLASDFKDRTIHMIDVNERAVELSNENAEQNGITNVKIYQSDLFSN
VDSAQTFASILTNPPIRAGKKVVHAIFEKSAEHLKASGELWIVIQKKQGAPSAIEKLEEL
FDEVSVVQKKKGYYIIKAKKV
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagtgagcactattattcagaaaaaccttcagtaaaaagcaacaagcaaacctggtct
tttaggcttcggaataaagatttcacgtttaccagcgacagcggggttttttctaaaaaa
gaagttgatttcggctcccgcctgctgattgattcttttgaagagcctgaggttgagggc
ggcattttagatgtaggctgcggatacggcccgattggtttatcgctcgccagcgacttt
aaagaccggaccatccacatgattgacgttaatgagagagccgtagaactatcaaatgaa
aatgcggaacagaacggaataacaaacgttaagatttatcaaagcgatttgttttcaaac
gttgattctgctcaaacatttgcttctattcttacaaatcccccaatccgagccggaaaa
aaagttgtccatgctatctttgagaaaagcgctgaacacttaaaagcttcaggtgaattg
tggatcgtcatacagaaaaagcaaggcgcgccttctgccattgaaaagctcgaggaactg
ttcgatgaagtttccgtcgttcaaaaaaagaaaggctattatatcataaaagcaaaaaaa
gtttga

DBGET integrated database retrieval system