KEGG   Bacillus subtilis subsp. subtilis 168: BSU01090
Entry
BSU01090          CDS       T00010                                 

Gene name
ybxF
Definition
(RefSeq) ribosome-associated protein L7Ae-like
  KO
K07590  large subunit ribosomal protein L7A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01090 (ybxF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01090 (ybxF)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    BSU01090 (ybxF)
SSDB
Motif
Pfam: Ribosomal_L7Ae PELOTA_1 SpoU_sub_bind eRF1_3
Other DBs
NCBI-GeneID: 936829
NCBI-ProteinID: NP_387990
Pasteur: BG11365
BSORF: BG11365
UniProt: P46350
Structure
PDB: 

Position
129340..129588
AA seq 82 aa
MSYDKVSQAKSIIIGTKQTVKALKRGSVKEVVVAKDADPILTSSVVSLAEDQGISVSMVE
SMKKLGKACGIEVGAAAVAIIL
NT seq 249 nt   +upstreamnt  +downstreamnt
atgtcttatgataaagtatcacaggccaaatcaattattattggtacgaagcaaacagtg
aaagctctaaagcgaggttcagtaaaggaagtagtcgttgcaaaagacgcagatccgata
ctcacgtcaagtgttgtttcacttgctgaagatcaaggtatctctgtctcaatggttgaa
tccatgaaaaagctcggcaaagcctgcggaattgaggtaggagcagccgctgttgccatt
attttataa

DBGET integrated database retrieval system