KEGG   Bacillus subtilis subsp. subtilis 168: BSU01160
Entry
BSU01160          CDS       T00010                                 

Gene name
rplC
Definition
(RefSeq) 50S ribosomal protein L3
  KO
K02906  large subunit ribosomal protein L3
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01160 (rplC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01160 (rplC)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01160 (rplC)
  Bacteria
    BSU01160 (rplC)
  Archaea
    BSU01160 (rplC)
SSDB
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-GeneID: 936239
NCBI-ProteinID: NP_387997
Pasteur: BG11218
BSORF: BG11218
UniProt: P42920
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
135712..136341
AA seq 209 aa
MTKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDGYEAIQLGFDDKREKL
SNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSAGEIVDVTGVSKGKGFQ
GAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVD
AERNLLLIKGNVPGAKKSLITVKSAVKSK
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaccaaaggaatcttaggaagaaaaattggtatgacgcaagtattcgctgagaatggt
gatcttattccggtaactgttatcgaggctgctccaaacgttgttcttcaaaagaaaaca
gctgaaaacgacggttacgaagcaatccagcttggttttgacgacaagcgtgaaaagctt
tctaacaaacctgaaaaagggcacgttgcaaaagcggaaactgctcctaagcgcttcgtt
aaagaattacgcggagtggaaatggatgcgtatgaagttggtcaggaagtcaaggttgaa
attttctctgctggagaaatcgtagatgtaacaggagtatctaaaggtaaaggtttccaa
ggtgcgatcaagcgccacggacaatctcgcggacctatgtctcacggttcacgctaccac
cgtcgtcctggttcaatgggacctgtagatcctaaccgtgtattcaaaggtaaattatta
cctggacgtatgggcggagagcaaatcactgttcaaaaccttgaaatcgtaaaagttgat
gcagaacgcaatcttcttttgatcaaaggtaacgtacctggtgcgaagaaatctttaatc
actgttaaaagtgctgttaaatctaaataa

DBGET integrated database retrieval system