KEGG   Bacillus subtilis subsp. subtilis 168: BSU01170
Entry
BSU01170          CDS       T00010                                 

Gene name
rplD
Definition
(RefSeq) 50S ribosomal protein L4
  KO
K02926  large subunit ribosomal protein L4
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01170 (rplD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01170 (rplD)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01170 (rplD)
  Bacteria
    BSU01170 (rplD)
SSDB
Motif
Pfam: Ribosomal_L4 DHHA1 Sarcoglycan_1 CPP1-like
Other DBs
NCBI-GeneID: 936690
NCBI-ProteinID: NP_387998
Pasteur: BG11219
BSORF: BG11219
UniProt: P42921
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
136369..136992
AA seq 207 aa
MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGTHKVKNRSEVRGG
GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSVLSSKVID
NNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAVALSARNIPGVTVVEANG
INVLDVVNHEKLLITKAAVEKVEEVLA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgccaaaagtagcattatacaaccaaaacggttctactgctggtgacatcgaattaaac
gcttctgtatttggtatcgaaccaaatgagagtgttgtattcgacgctattcttatgcaa
agagcttccttacgtcaaggaactcacaaagtaaaaaatcgttctgaagtacgcggcgga
ggtcgtaaaccatggcgtcaaaaaggtactggacgtgcccgtcaaggttcaatccgttca
ccgcaatggcgcggaggtggtgtcgtattcggcccaacaccacgcagctattcttataaa
ttacctaaaaaagttcgccgcttggcaatcaaatcagtattgtcttctaaagtgatcgac
aacaacatcatcgttcttgaagatcttactcttgatacggctaaaacaaaagaaatggca
gctatccttaaaggattatctgttgagaaaaaagctttaatcgtaactgcggatgcaaac
gaagcagtagcattatctgctcgtaacattcctggagttactgttgttgaagctaacgga
atcaacgttttagacgttgtcaaccacgagaagcttctgattacaaaagcagcggttgaa
aaagtagaggaggtgcttgcataa

DBGET integrated database retrieval system