KEGG   Bacillus subtilis subsp. subtilis 168: BSU01180Help
Entry
BSU01180          CDS       T00010                                 

Gene name
rplW
Definition
(RefSeq) 50S ribosomal protein L23
  KO
K02892  large subunit ribosomal protein L23
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01180 (rplW)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01180 (rplW)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01180 (rplW)
  Bacteria
    BSU01180 (rplW)
  Archaea
    BSU01180 (rplW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L23
Motif
Other DBs
NCBI-GeneID: 936820
NCBI-ProteinID: NP_387999
Pasteur: BG11221
BSORF: BG11221
UniProt: P42924
Structure
PDB: 

Position
136992..137279
Genome map
AA seq 95 aa AA seqDB search
MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKVDKVNIMNYK
GKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcctcgtgatgttctaaagcgccccgtcattactgaacgttctgccgattta
atgactgaaaaaaaatatacttttgaagttgatgtaagagctaacaaaacagaagtgaaa
gacgcggttgaaagcatctttggagtgaaagttgacaaagtcaacatcatgaactacaaa
ggcaaatcaaaacgtgttggacgctacactggtatgactagccgtcgcagaaaagcgatc
gtaaaacttactgcagacagcaaagaaatcgaaatttttgaagcttaa

DBGET integrated database retrieval system