KEGG   Bacillus subtilis subsp. subtilis 168: BSU01210Help
Entry
BSU01210          CDS       T00010                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01210 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01210 (rplV)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01210 (rplV)
  Bacteria
    BSU01210 (rplV)
  Archaea
    BSU01210 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 938123
NCBI-ProteinID: NP_388002
Pasteur: BG11078
BSORF: BG11078
UniProt: P42060
Structure
PDB: 

Position
138497..138838
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEH
NYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagtccgtattgctcctcgtaaagcacgtctagta
atggacctgattcgaggcaagcaagtaggtgaggcagtatcaatcttgaaccttacacca
agagctgcttctccaattatcgagaaagtattaaaatccgctattgcaaatgctgagcat
aactatgaaatggacgctaacaacctggttatttctcaagcattcgttgacgaaggccct
acgttaaaaagattccgcccacgtgctatgggacgtgcgagccaaatcaacaaacgtacg
agccacattacaatcgttgtatcagaaaagaaggagggataa

DBGET integrated database retrieval system