KEGG   Bacillus subtilis subsp. subtilis 168: BSU01230Help
Entry
BSU01230          CDS       T00010                                 

Gene name
rplP
Definition
(RefSeq) 50S ribosomal protein L16
  KO
K02878  large subunit ribosomal protein L16
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01230 (rplP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01230 (rplP)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01230 (rplP)
  Bacteria
    BSU01230 (rplP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L16
Motif
Other DBs
NCBI-GeneID: 936807
NCBI-ProteinID: NP_388004
Pasteur: BG10755
BSORF: BG10755
UniProt: P14577
Position
139500..139934
Genome map
AA seq 144 aa AA seqDB search
MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNRQIEAARIAMTRYMKR
GGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLFEISGVSEEVAREALRL
ASHKLPIKTKFVKREEIGGESNES
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgttattaccaaaacgcgttaaatatcgcagagagcatcgcggaaaaatgcgtggccgt
gcgaaaggcggtactgaagtacatttcggagaattcggtatccaagctctagaagcttct
tggattactaaccgtcaaatcgaagctgcacgtattgcgatgactcgttacatgaaacgt
ggcggtaaagtttggatcaaaattttcccttctaaaccttacactgctaaaccacttgag
gtacgtatgggatccggtaaaggggctccagaaggttgggtagctgttgtaaaaccgggc
aaagttttatttgaaatttctggtgtgtctgaagaggttgctcgtgaagcgcttcgcctt
gcatctcacaaattgccaattaaaacgaagttcgtaaaacgtgaagaaattggtggtgaa
tcaaatgaaagctaa

DBGET integrated database retrieval system