KEGG   Bacillus subtilis subsp. subtilis 168: BSU01240Help
Entry
BSU01240          CDS       T00010                                 

Gene name
rpmC
Definition
(RefSeq) 50S ribosomal protein L29
  KO
K02904  large subunit ribosomal protein L29
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Module
bsu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01240 (rpmC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01240 (rpmC)
Ribosome [BR:bsu03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    BSU01240 (rpmC)
  Archaea
    BSU01240 (rpmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L29 DUF2046 SpoVIF DUF642 MRP-L47
Motif
Other DBs
NCBI-GeneID: 936801
NCBI-ProteinID: NP_388005
Pasteur: BG10756
BSORF: BG10756
UniProt: P12873
Structure
PDB: 

Position
139924..140124
Genome map
AA seq 66 aa AA seqDB search
MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAIARMKTVIRER
EIAANK
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctaatgaaattcgtgaccttaccactgctgaaattgaacaaaaagtaaagtct
cttaaagaagaacttttcaatcttcgctttcaattagcgacaggacaacttgaaaatact
gctcgcattcgtgaagtgcgcaaagctatcgcgcgcatgaaaactgtgattcgtgaaaga
gaaattgctgctaataaataa

DBGET integrated database retrieval system