KEGG   Bacillus subtilis subsp. subtilis 168: BSU01260Help
Entry
BSU01260          CDS       T00010                                 

Gene name
rplN
Definition
(RefSeq) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01260 (rplN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01260 (rplN)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01260 (rplN)
  Bacteria
    BSU01260 (rplN)
  Archaea
    BSU01260 (rplN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L14
Motif
Other DBs
NCBI-GeneID: 935939
NCBI-ProteinID: NP_388007
Pasteur: BG10758
BSORF: BG10758
UniProt: P12875
Structure
PDB: 

Position
140451..140819
Genome map
AA seq 122 aa AA seqDB search
MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQATPGGVVKKGEVVKA
VIVRTKSGARRSDGSYISFDENACVIIRDDKSPRGTRIFGPVARELRENNFMKIVSLAPE
VI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacaagagactcgtttaaaagtagctgacaactctggcgcacgtgaagtactt
actattaaagttcttggtggttctggacgtaaaacagctaacattggtgatgtaattgtt
tgcacggttaaacaagcaacaccaggaggcgttgtcaaaaaaggtgaagtcgtaaaagct
gttatcgttcgcactaaaagcggagcgcgcagaagtgacggttcatacatcagcttcgat
gagaatgcatgtgttatcatccgtgacgacaagagcccacgcggaactcgtatcttcgga
ccagttgctcgtgaattgcgtgaaaacaactttatgaaaattgtttctctagctccagaa
gttatctaa

DBGET integrated database retrieval system