KEGG   Bacillus subtilis subsp. subtilis 168: BSU01270Help
Entry
BSU01270          CDS       T00010                                 

Gene name
rplX
Definition
(RefSeq) 50S ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01270 (rplX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01270 (rplX)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01270 (rplX)
  Bacteria
    BSU01270 (rplX)
  Archaea
    BSU01270 (rplX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ribosomal_L24 KOW
Motif
Other DBs
NCBI-GeneID: 936799
NCBI-ProteinID: NP_388008
Pasteur: BG10759
BSORF: BG10759
UniProt: P0CI78
Structure
PDB: 

Position
140857..141168
Genome map
AA seq 103 aa AA seqDB search
MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQE
APIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtaaaaaaaggcgataaagttatggttatctctggtaaagataaaggcaaacaa
ggaacaatccttgctgctttccctaaaaaggaccgcgttttagttgaaggtgttaacatg
gtaaagaaacactctaaaccaactcaagctaaccctcaaggcggtatttctaatcaagag
gcgccaattcatgtatcaaacgttatgccgctcgatcctaaaacaggtgaagtgactcgc
gtaggatacaaagtggaagatggcaaaaaagttcgtgtagcaaaaaaatctgggcaagtt
ctagataaatag

DBGET integrated database retrieval system