KEGG   Bacillus subtilis subsp. subtilis 168: BSU01280Help
Entry
BSU01280          CDS       T00010                                 

Gene name
rplE
Definition
(RefSeq) 50S ribosomal protein L5
  KO
K02931  large subunit ribosomal protein L5
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01280 (rplE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01280 (rplE)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01280 (rplE)
  Bacteria
    BSU01280 (rplE)
  Archaea
    BSU01280 (rplE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5_C Ribosomal_L5
Motif
Other DBs
NCBI-GeneID: 936981
NCBI-ProteinID: NP_388009
Pasteur: BG10760
BSORF: BG10760
UniProt: P12877
Structure
PDB: 

Position
141195..141734
Genome map
AA seq 179 aa AA seqDB search
MNRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAIDSAVEELTFI
AGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLISVSLPRVRDFRGVSKK
SFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTDEEARELLTQVGMPFQK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccttaaagaaaagtacaataaagaaattgcacctgctttaatgactaagttc
aactatgattcagtcatgcaagtgcctaaaatcgaaaaaatcgtaatcaacatgggtgtt
ggtgacgctgttcaaaacgccaaagcaatcgacagtgctgttgaggaattaacgtttatc
gcaggtcaaaaacctgtcgttactcgtgcgaagaaatcaattgctggattccgtcttcgt
gagggaatgcctatcggtgcgaaagtaactcttcgcggagagcgcatgtatgatttcctt
gataaacttatttctgtatctttaccgcgtgtacgtgacttccgcggggtttctaaaaaa
tctttcgacggtcgcggtaactacacacttggtatcaaagaacagttaatcttccctgaa
attgactacgataaagtaacaaaggttcgcggaatggacatcgttatcgtaacaactgct
aatactgacgaagaagctcgtgagctattaactcaagtaggtatgccgttccagaaataa

DBGET integrated database retrieval system