KEGG   Bacillus subtilis subsp. subtilis 168: BSU01310
Entry
BSU01310          CDS       T00010                                 

Gene name
rplF
Definition
(RefSeq) 50S ribosomal protein L6
  KO
K02933  large subunit ribosomal protein L6
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01310 (rplF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01310 (rplF)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01310 (rplF)
  Bacteria
    BSU01310 (rplF)
  Archaea
    BSU01310 (rplF)
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-GeneID: 938229
NCBI-ProteinID: NP_388012
Pasteur: BG11408
BSORF: BG11408
UniProt: P46898
Structure
PDB: 
6PPK 3J3W 3J3V

Position
142402..142941
AA seq 179 aa
MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPDMEIKVEDNVLTVARPSDQK
EHRALHGTTRSLLGNMVEGVSKGFERGLELVGVGYRASKSGNKLVLNVGYSHPVEIVPEE
GIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtctcgtgtaggtaagaagctacttgagattccttctgatgttacagtaacgttaaat
gataacaacactgtagctgtgaaaggaccaaaaggagaattaactcgtacgtttcaccct
gatatggagattaaagtagaggacaatgtgcttacagtcgctcgtccttctgatcaaaaa
gagcaccgtgccctgcatggtacgactcgcagtctgcttggcaacatggttgaaggtgta
tctaaaggatttgaaagaggtttggaattagtcggtgtcggttaccgtgcttctaaatcc
ggaaataaacttgttttaaacgttggatactctcatcctgttgagatcgttcctgaagaa
ggcatcgaaatcgaagttccttctcaaacaaaagtagttgtaaaaggtacagacaaagaa
cgcgtaggagctattgctgctaacatccgcgctgtacgttctccagagccttacaaaggt
aaaggaatccgctacgaaggtgaagttgttcgccgtaaagaaggtaaatctgctaagtaa

DBGET integrated database retrieval system