KEGG   Bacillus subtilis subsp. subtilis 168: BSU01320
Entry
BSU01320          CDS       T00010                                 

Gene name
rplR
Definition
(RefSeq) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01320 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01320 (rplR)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01320 (rplR)
  Bacteria
    BSU01320 (rplR)
  Archaea
    BSU01320 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-GeneID: 936785
NCBI-ProteinID: NP_388013
Pasteur: BG11409
BSORF: BG11409
UniProt: P46899
Structure
PDB: 
6PPF 6PPK 3J3V

Position
142974..143336
AA seq 120 aa
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNGVTLASASTLD
KDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGYLYHGRVKALADAAREAGLKF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgattacgaaaactagcaaaaatgctgctcgtcttaaaagacacgctcgtgttcgcgct
aaactttccggtactgctgaaagaccgcgcctgaacgttttccgttctaacaagcacatt
tacgctcaaatcatcgatgatgtaaatggtgtaacacttgctagtgcatctactctcgat
aaagacttgaacgttgaaagcactggagatacttctgctgctactaaagttggagaatta
gttgcaaaacgcgctgctgaaaaaggcatttctgacgtagtatttgaccgtggcggatac
ttataccatggacgtgtaaaagctttggctgatgccgctcgtgaagctggacttaaattt
taa

DBGET integrated database retrieval system