KEGG   Bacillus subtilis subsp. subtilis 168: BSU01340
Entry
BSU01340          CDS       T00010                                 

Gene name
rpmD
Definition
(RefSeq) 50S ribosomal protein L30
  KO
K02907  large subunit ribosomal protein L30
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01340 (rpmD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01340 (rpmD)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01340 (rpmD)
  Bacteria
    BSU01340 (rpmD)
  Archaea
    BSU01340 (rpmD)
SSDB
Motif
Pfam: Ribosomal_L30
Other DBs
NCBI-GeneID: 936920
NCBI-ProteinID: NP_388015
Pasteur: BG10443
BSORF: BG10443
UniProt: P19947
Structure
PDB: 
6PPF 6PPK 3J3V

Position
143875..144054
AA seq 59 aa
MAKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIRGMINKVSHLVSVKEQ
NT seq 180 nt   +upstreamnt  +downstreamnt
atggctaaattagaaattaccctcaaacgaagtgtaatcggtcgcccggaagaccaacgc
gttactgtaagaacacttggtttaaagaaaacaaaccaaactgttgttcatgaagacaac
gctgcgatccgtggtatgattaataaagtatctcatttagtttctgttaaagaacaataa

DBGET integrated database retrieval system