KEGG   Bacillus subtilis subsp. subtilis 168: BSU01350
Entry
BSU01350          CDS       T00010                                 

Gene name
rplO
Definition
(RefSeq) 50S ribosomal protein L15
  KO
K02876  large subunit ribosomal protein L15
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01350 (rplO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01350 (rplO)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01350 (rplO)
  Bacteria
    BSU01350 (rplO)
  Archaea
    BSU01350 (rplO)
SSDB
Motif
Pfam: Ribosomal_L27A
Other DBs
NCBI-GeneID: 935940
NCBI-ProteinID: NP_388016
Pasteur: BG10444
BSORF: BG10444
UniProt: P19946
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
144085..144525
AA seq 146 aa
MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGFEGGQMPLFQR
LPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKLEKK
LTVKANKFSASAKEAVEAAGGTAEVI
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaaacttcatgaattaaaaccttcagaaggttcacgcaaaacgcgtaatcgcgtaggt
cgtggtattggttctggcaacggtaaaacagctggtaaaggtcacaaaggtcaaaacgct
cgttctggcggcggtgtacgccctggattcgaggggggacaaatgcctttattccaacgt
cttcctaaacgtggtttcactaacatcaaccgcaaggaatacgctgtagtcaacctagac
aaattgaacggttttgcagaaggaacggaagtcactcctgaacttcttctagagactggt
gttattagcaaacttaatgcaggagtaaagattcttggcaacggtaaattagagaaaaaa
ttaactgtaaaagccaataaattctctgcttctgcgaaagaagctgttgaagctgctggc
ggtacagctgaggtgatctaa

DBGET integrated database retrieval system