KEGG   Bacillus subtilis subsp. subtilis 168: BSU01400Help
Entry
BSU01400          CDS       T00010                                 

Gene name
rpmJ
Definition
(RefSeq) 50S ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01400 (rpmJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01400 (rpmJ)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01400 (rpmJ)
  Bacteria
    BSU01400 (rpmJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L36
Motif
Other DBs
NCBI-GeneID: 938927
NCBI-ProteinID: NP_388021
Pasteur: BG11042
BSORF: BG11042
UniProt: P20278
Position
147837..147950
Genome map
AA seq 37 aa AA seqDB search
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgagaccatcagttaaaccaatctgcgaaaaatgtaaagttattcgcagaaaa
ggaaaagtaatggtgatctgtgaaaatccaaagcataaacaaaaacaaggataa

DBGET integrated database retrieval system