KEGG   Bacillus subtilis subsp. subtilis 168: BSU01430
Entry
BSU01430          CDS       T00010                                 

Symbol
rpoA
Name
(RefSeq) DNA-directed RNA polymerase subunit alpha
  KO
K03040  DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    BSU01430 (rpoA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU01430 (rpoA)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU01430 (rpoA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     BSU01430 (rpoA)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     BSU01430 (rpoA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      BSU01430 (rpoA)
SSDB
Motif
Pfam: RNA_pol_A_CTD RNA_pol_A_bac RNA_pol_L PASTA HHH_5
Other DBs
NCBI-GeneID: 938921
NCBI-ProteinID: NP_388024
Pasteur: BG10732
BSORF: BG10732
UniProt: P20429 A0A6M3Z9W8
Structure
PDB: 
1Z3E 3IHQ 3GFK

Position
148931..149875
AA seq 314 aa
MIEIEKPKIETVEISDDAKFGKFVVEPLERGYGTTLGNSLRRILLSSLPGAAVTSIQIDG
VLHEFSTIEGVVEDVTTIILHIKKLALKIYSDEEKTLEIDVQGEGTVTAADITHDSDVEI
LNPDLHIATLGENASFRVRLTAQRGRGYTPADANKRDDQPIGVIPIDSIYTPVSRVSYQV
ENTRVGQVANYDKLTLDVWTDGSTGPKEAIALGSKILTEHLNIFVGLTDEAQHAEIMVEK
EEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKTEEDMMKVRNLGRKSLEEVK
AKLEELGLGLRKDD
NT seq 945 nt   +upstreamnt  +downstreamnt
atgatcgagattgaaaaaccaaaaatcgaaacggttgaaatcagcgacgatgccaaattt
ggtaagtttgtcgtagagccacttgagcgtggatatggtacaactctgggtaactcctta
cgtcgtatcctcttatcctcactccctggtgccgctgtaacatcaatccagatagatggt
gtactgcacgaattctcgacaattgaaggcgttgtggaagatgttacaacgattatctta
cacattaaaaagcttgcattgaaaatctactctgatgaagagaagacgctagaaattgat
gtacagggtgaaggaactgtaacggcagctgatattacacacgatagtgatgtagagatc
ttaaatcctgatcttcatatcgcgactcttggtgagaatgcgagtttccgagttcgcctt
actgctcaaagaggacgtgggtatacgcctgctgacgcaaacaagagagacgatcagcca
atcggcgtgattccgatcgattctatctatacgccagtttctcgtgtatcttatcaggta
gagaacactcgtgtaggccaagttgcaaactatgataaacttacacttgatgtttggact
gatggaagcactggaccgaaagaagcaattgcgcttggttcaaagattttaactgaacac
cttaatatattcgttggtttaactgacgaagctcaacatgctgaaatcatggttgaaaaa
gaagaagatcaaaaagagaaagttcttgaaatgacaattgaagaattggatctttctgtt
cgttcttacaactgcttaaagcgtgcgggtattaacacggttcaagagcttgcgaacaag
acggaagaagatatgatgaaagttcgaaatctaggacgcaaatcacttgaagaagtgaaa
gcgaaactagaagaacttggactcggacttcgcaaagacgattga

DBGET integrated database retrieval system