KEGG   Bacillus subtilis subsp. subtilis 168: BSU01440
Entry
BSU01440          CDS       T00010                                 

Gene name
rplQ
Definition
(RefSeq) 50S ribosomal protein L17
  KO
K02879  large subunit ribosomal protein L17
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU01440 (rplQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU01440 (rplQ)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU01440 (rplQ)
  Bacteria
    BSU01440 (rplQ)
SSDB
Motif
Pfam: Ribosomal_L17 COMPASS-Shg1 DUF1638
Other DBs
NCBI-GeneID: 938918
NCBI-ProteinID: NP_388025
Pasteur: BG11041
BSORF: BG11041
UniProt: P20277
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
149953..150315
AA seq 120 aa
MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVEKMITLGKRGDLHARR
QAAAYIRNEVANEENNQDALQKLFSDIATRYEERQGGYTRIMKLGPRRGDGAPMAIIELV
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtcatacagaaaactaggacgtacgagtgcacagcgtaaagctatgcttcgtgatctt
acaactgatttgatcatcaacgaaagaatcgaaacaactgaaacacgtgcgaaagaactt
cgctctgtagttgaaaaaatgatcacgcttggcaaacgcggtgatcttcacgctcgccgt
caagctgctgcatacatccgcaacgaggttgcaaacgaagaaaataatcaagatgcactt
caaaaattattctctgacattgcaactcgttacgaggagcgccaaggtggatacacacgt
attatgaagcttggtcctcgccgtggtgacggagcaccaatggcaattatcgaattggtt
taa

DBGET integrated database retrieval system