KEGG   Bacillus subtilis subsp. subtilis 168: BSU01560
Entry
BSU01560          CDS       T00010                                 

Symbol
kbaA
Name
(RefSeq) kinB-signaling pathway activation protein
  KO
K06349  KinB signaling pathway activation protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU01560 (kbaA)
SSDB
Motif
Pfam: KbaA DUF2545
Other DBs
NCBI-GeneID: 938913
NCBI-ProteinID: NP_388037
Pasteur: BG10643
BSORF: BG10643
UniProt: P16449 A0A6M3ZBZ3
Position
159182..159778
AA seq 198 aa
MKSRGLVRFFFSILAVGALITSIVGFALKWGEYRGLFLTFEAGQIFSVLFWFIGVGMIFS
VISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMYVRFLFFGESGESLAGY
AWLPVFLLIFGVITAYIKQKQSSKKTFVSSLFLMVVITALEWFPALRVNDEDWLYLMLFP
LMACNAFQLLMLPKFAAK
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaaaagccgtggtttagttcgttttttcttttctattttagctgtcggggcgcttatc
acgagtattgtgggttttgctttaaagtggggagaatatagagggctgtttctaacattt
gaagcgggacagattttctctgttttattttggtttatcggtgtaggcatgattttcagt
gtgatcagccaaatgggttttttcgtgtttttaacagttcatcggtttgcgcttgagata
ttaaggtcctcctctttgtggaatttgctgcagttgtttttcatcctgtttgttgctttt
gatttaatgtacgtgcgttttttattttttggagagagcggagaatcgctggctggctat
gcgtggttaccggtgtttttattgatctttggagtgattacagcttatataaagcaaaag
cagtcctctaagaaaacatttgtgtcatcgttatttttgatggttgtgattaccgcatta
gaatggttccctgcattaagagtaaatgatgaggactggctttatttaatgctttttccg
ttaatggcatgtaatgccttccaattgctgatgctgccgaagtttgcagcaaagtaa

DBGET integrated database retrieval system