KEGG   Bacillus subtilis subsp. subtilis 168: BSU01570
Entry
BSU01570          CDS       T00010                                 

Gene name
ybaN
Definition
(RefSeq) polysaccharide deacetylase PdaB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Polysacc_deac_1 Peripla_BP_4 OmpH
Other DBs
NCBI-GeneID: 938911
NCBI-ProteinID: NP_388038
Pasteur: BG11416
BSORF: BG11416
UniProt: P50865 A0A6M3Z7B6
Position
complement(159779..160543)
AA seq 254 aa
MNHFYVWHIKRVKQLIIILIAAFAAASFFYIQRAVPLPVFSTDTGPKAIYKGETDSKDIS
LTFDISWGDERAEPILNTLKANGIKNATFFLSASWAERHPDTVARIVKDGHQIGSMGYAY
KNYANLESSEIKKDMNRAQTAFEKLGVKDIQLLRPPTGQFNKNVLKVAKQYNYTVVHYSV
NSQDWTNPGVEKIIDNVTKQVSGGDIILLHASDSAKQTEEALPDIIHQLKEKGLKNVTVG
DLIANSDAKSAEVK
NT seq 765 nt   +upstreamnt  +downstreamnt
gtgaatcacttctatgtgtggcacattaaacgggtaaaacaattaattattatacttatc
gccgcatttgcagctgccagctttttttatatccaaagagctgtcccgcttcccgtgttt
tcaactgacaccggacctaaagccatttataaaggagaaacagactctaaagatatttca
cttactttcgatatcagctggggtgatgagagagcagaaccgatacttaatactctgaaa
gcaaacgggattaaaaacgcaacgtttttcctgtccgcttcttgggcagaacgccatccc
gacacagtggcccgtatcgtaaaggacggccatcaaatcgggagcatgggctacgcttat
aaaaactatgccaatttagagagcagcgaaataaaaaaggacatgaaccgtgcgcaaaca
gcctttgaaaagttaggggtcaaagacatacagctattaagaccccctaccggccaattc
aataagaatgttctaaaggtcgcaaagcaatacaattatacagtcgttcattacagtgtg
aactctcaagactggacaaatcccggagttgaaaaaatcatcgacaatgtgaccaagcaa
gtttccggtggagacattattcttttacatgcctccgattctgcaaaacaaacagaagaa
gcattgcctgatatcatccatcagctgaaagaaaaaggattaaaaaatgtaaccgtgggt
gatctcatcgcaaattctgatgccaaatccgcagaggtaaagtaa

DBGET integrated database retrieval system