KEGG   Bacillus subtilis subsp. subtilis 168: BSU01600Help
Entry
BSU01600          CDS       T00010                                 

Gene name
ybbA
Definition
(RefSeq) hypothetical protein
  KO
K07017  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU01600 (ybbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 938887
NCBI-ProteinID: NP_388041
Pasteur: BG11565
BSORF: BG11565
UniProt: P55192
Position
complement(179595..180347)
Genome map
AA seq 250 aa AA seqDB search
MKGSLSEHKAGNRRFTLYLPPSYSTDSGGFPAVYVQDGSSLFQNQIELLESAFQQQRLPE
LVLIGIEPENRLDEYTPWPAASLSDRFTDFGGMGYHYLSDITNQFIPLIEENWNVTREPQ
SRGMIGASLGGLISMFAILKYPSMFGKIGSISGSYWYENAAETIHISSLKPGTARVFMSI
GSEEGREKQSIQRHMLKKTKQVHQSLKEKGFTEDQLCLSIEKGAVHHHKYFCKQFINALE
WLYGKNRSTL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggatctctttcagaacacaaagccggcaacaggaggttcacgctgtacctccct
ccttcctacagcacagacagcgggggatttcctgctgtttacgtgcaggatggcagttct
ttgttccaaaaccaaatcgaattactagaaagcgcctttcaacagcaaaggctccctgaa
ctcgtgctgatcggtatcgaacccgaaaaccggcttgatgaatacaccccatggccggct
gcatcactcagtgatcggttcacggacttcggcggaatgggatatcactatctgtctgat
ataacgaaccagttcattccgctaatcgaagaaaactggaacgtcaccagggaaccgcag
tcaagaggaatgatcggtgcctcattaggcggcctcatctcaatgttcgccatattaaaa
tatccgtcaatgttcgggaaaataggctctatatcaggttcatactggtacgagaacgca
gcggaaaccattcatatatcttctttaaagcccggcactgcacgtgttttcatgtctatc
gggagtgaagaaggccgtgaaaaacaatccattcagcgacatatgctgaaaaaaacaaag
caagttcatcaaagtctaaaagaaaaaggcttcactgaagaccagttgtgtctttcaatt
gaaaaaggagcggtgcaccaccacaagtatttctgcaaacagttcatcaacgcgctcgaa
tggctatacggaaaaaaccgctcaaccctatga

DBGET integrated database retrieval system