KEGG   Bacillus subtilis subsp. subtilis 168: BSU01620
Entry
BSU01620          CDS       T00010                                 

Symbol
feuB
Name
(RefSeq) iron-uptake system permease protein FeuB
  KO
K02015  iron complex transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU01620 (feuB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BSU01620 (feuB)
SSDB
Motif
Pfam: FecCD Spore_YabQ Phage_holin_2_1 DUF6450 DUF2613
Other DBs
NCBI-GeneID: 938884
NCBI-ProteinID: NP_388043
Pasteur: BG10836
BSORF: BG10836
UniProt: P40410 A0A6M4JHW6
Position
complement(181347..182351)
AA seq 334 aa
MYSKQWTRIILITSPFAIALSLLLSILYGAKHLSTDIVFTSLIHFDPGNTDHQIIWHSRI
PRAAGALLIGAALAVSGALMQGITRNYLASPSIMGVSDGSAFIITLCMVLLPQSSSIEMM
IYSFIGSALGAVLVFGLAAMMPNGFTPVQLAIIGTVTSMLLSSLSAAMSIYFQISQDLSF
WYSARLHQMSPDFLKLAAPFFLIGIIMAISLSKKVTAVSLGDDISKSLGQKKKTIKIMAM
LSVIILTGSAVALAGKIAFVGLVVPHITRFLVGSDYSRLIPCSCILGGIFLTLCDLASRF
INYPFETPIEVVTSIIGVPFFLYLIKRKGGEQNG
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtattcaaaacagtggacacgtatcatattgattacttctccatttgctatagcgctg
tcacttttgctttcaatcctttatggggcaaagcatctcagcacagatattgtttttaca
tctcttattcatttcgatccgggaaacacagaccatcaaattatatggcattcccggatt
ccaagggctgccggcgctctgctcataggggcagcccttgctgtttctggagcgcttatg
cagggcattacgcgcaattatttagcttcgccatccattatgggtgtttcagatggttca
gcgtttatcattacgctttgcatggttctgctcccgcaatcatcttcgattgaaatgatg
atatactcttttatcggctcagcgttaggagcggtgttagtattcggccttgccgccatg
atgccaaacggatttacccccgtgcagctcgccatcatcggcacagtcacaagcatgctg
ctcagcagcttatcagcggccatgtcgatttattttcaaatttctcaggatctcagtttc
tggtacagtgccagacttcatcaaatgagtccagatttcctgaagcttgccgctccgttt
ttcctgattggcattataatggccatttctctcagcaaaaaggtaaccgctgtatcatta
ggggacgacatttctaaaagcctggggcaaaagaaaaaaaccattaaaatcatggcgatg
ctttccgtcatcattctaaccggcagtgccgtagcgctggccggaaaaattgcgtttgtc
gggttggttgttccgcatatcacgagatttctcgtcggctctgattacagcaggctgatt
ccgtgttcctgtattttgggcggaatctttttaaccctgtgtgatctcgcaagcagattt
atcaactatccgtttgaaacaccgattgaggtcgtaacatccattatcggcgtacctttc
ttcctttatttaattaaacgaaaaggaggggagcaaaatggctaa

DBGET integrated database retrieval system