KEGG   Bacillus subtilis subsp. subtilis 168: BSU01630
Entry
BSU01630          CDS       T00010                                 

Symbol
feuA
Name
(RefSeq) iron-uptake system-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU01630 (feuA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BSU01630 (feuA)
SSDB
Motif
Pfam: Peripla_BP_2 DUF2031 DIM
Other DBs
NCBI-GeneID: 938891
NCBI-ProteinID: NP_388044
Pasteur: BG10835
BSORF: BG10835
UniProt: P40409 A0A6M4JC72
Structure
PDB: 
2WI8 2WHY 2XUZ 2XV1 2PHZ

Position
complement(182370..183323)
AA seq 317 aa
MKKISLTLLILLLALTAAACGSKNESTASKASGTASEKKKIEYLDKTYEVTVPTDKIAIT
GSVESMEDAKLLDVHPQGAISFSGKFPDMFKDITDKAEPTGEKMEPNIEKILEMKPDVIL
ASTKFPEKTLQKISTAGTTIPVSHISSNWKENMMLLAQLTGKEKKAKKIIADYEQDLKEI
KTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGLKAPNEVKAAKAQELSSLE
KLSEMNPDHIFVQFSDDENADKPDALKDLEKNPIWKSLKAVKEDHVYVNSVDPLAQGGTA
WSKVRFLKAAAEKLTQN
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaaaaagatatctcttaccttattaatcttacttctcgcgctgacggcggcagcttgc
ggcagcaaaaatgaatcaactgccagcaaggcaagcggcacagcatctgagaagaagaaa
attgaataccttgataaaacatatgaagtaactgtaccgacagacaaaattgccattacg
ggaagcgttgaatcaatggaagacgcgaaattgcttgacgttcatccgcaaggcgcaatt
tcattctccggcaaattccctgatatgttcaaagacatcactgataaagccgaaccaacc
ggagaaaaaatggagccaaatattgaaaagattcttgaaatgaagccagatgttatcctt
gcttcaacaaagtttccggaaaaaacgctgcaaaaaatcagcacagcaggcacgacgatc
ccagtttctcatatctcttcaaactggaaggaaaacatgatgcttcttgcccagctgact
ggaaaagagaaaaaagcaaagaaaattattgcagactatgaacaggatctaaaagaaata
aaaacaaaaatcaacgataaagcgaaagattcaaaagcgcttgtcatcagaatcagacaa
ggcaacatttacatttaccctgaacaggtgtatttcaactccacactatacggtgattta
ggccttaaggcgccgaacgaagtaaaggctgcaaaagcgcaagagctgagttcattagaa
aaattaagtgaaatgaacccggaccatattttcgtccaattttctgatgatgaaaatgca
gacaaacctgatgccttaaaagatttagagaaaaatccaatctggaaaagccttaaagca
gtcaaagaagaccatgtgtatgtcaactcagtggaccctctcgcacaaggcggcacagct
tggagcaaagtccgtttcctgaaagcggctgctgaaaaattgacacaaaactaa

DBGET integrated database retrieval system