KEGG   Bacillus subtilis subsp. subtilis 168: BSU01690
Entry
BSU01690          CDS       T00010                                 

Symbol
ybbH
Name
(RefSeq) RpiR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_6 SIS SIS_2 Coatomer_WDAD
Other DBs
NCBI-GeneID: 938885
NCBI-ProteinID: NP_388050
Pasteur: BG11569
BSORF: BG11569
UniProt: Q45581 A0A6M3Z7B9
Structure
PDB: 
2O3F

Position
complement(191183..192034)
AA seq 283 aa
MATGGLAIIQSMKHKLPPSERKLADYILAHPHKAIESTVNEISALANSSDAAVIRLCKSL
GLKGFQDLKMRVAGDLAKPTFQGYRDIVPHEPLPSISEKTAGNAIQAIQDTSDLMDYKEL
ERAVSLLLKAHTVHFIGLGASGIVAKDAQQKWLRIHKQATAFTDTHLVASLIANADKDDI
VFAISFSGETQEIVELFAMAKEKGITTISLTQFSQTSVSALADVPLYTAHSNEALIRSAA
TSSRLAQLFIIDVLFLGMAAEQYETTTGYIDKTRAAIQSMRIK
NT seq 852 nt   +upstreamnt  +downstreamnt
atggccacaggcggtttagcgatcatccaatcaatgaagcataagctccctccatccgag
cgcaaacttgcagattatatcctagcccatccccacaaagcaatcgaaagcacggtcaac
gaaatcagcgccttagccaattcaagtgacgctgccgtcatcaggctctgcaaatcactc
ggtttaaaaggatttcaagatttaaaaatgagagtagcaggcgatctggcaaagcctacg
tttcagggctaccgggatattgttccccacgagccgctgccctccatttccgaaaaaacg
gccggcaatgccattcaagccattcaggatacttcagacctgatggactacaaagagctt
gaacgagcggtttctctgcttctcaaagctcataccgtgcattttatcggcctcggggct
tccggcattgtcgccaaggacgcccagcaaaagtggcttcgcattcataaacaagcaacc
gcgtttacagacactcatcttgtggcatctttaatcgcaaatgcagataaagacgacatc
gtattcgccatttcgttttcaggagagacacaggaaatcgttgaactgttcgccatggct
aaggaaaaaggcatcacaacgatcagcctcacacaattcagtcagacatccgtctccgca
ctggctgatgtccctttgtatacagcccattccaatgaagccttgattcgaagtgcagcc
acttcttcccgcctcgcccagctttttataattgatgttttgtttttaggcatggcggct
gagcagtatgaaacgacaaccggttatatagataaaacgagagcagccatacaatctatg
agaataaaataa

DBGET integrated database retrieval system