KEGG   Bacillus subtilis subsp. subtilis 168: BSU01710
Entry
BSU01710          CDS       T00010                                 

Symbol
ybbJ
Name
(RefSeq) N-acetyltransferase YbbJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_3 Acetyltransf_7
Other DBs
NCBI-GeneID: 938883
NCBI-ProteinID: NP_388052
Pasteur: BG11571
BSORF: BG11571
UniProt: Q45583 A0A6M4JJG6
Position
complement(193075..193557)
AA seq 160 aa
MTQDISLSFYKPEHLPELQSFTLTNDDKRFTSLPKEVLSQALGIQDRYPVVILKDDLPVG
FFILHASKETLASYSNNPFALLLSSLSLTAVHHGKGYAKKAMLLLPAFVSGYFPWCDEII
LAVNHLNIRAKHLYMKSGFLDKGRRRIGPLGEQLILHHFL
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactcaagacatttctttatccttctataagcctgaacacttgcccgagctccaatca
ttcacgctcaccaacgatgacaaacgctttacctccctcccgaaagaggtgctgtctcag
gctctgggcatacaggaccgatacccggttgtcatcttaaaagacgaccttccagtcggt
tttttcattttacatgcatcaaaagaaacgcttgcttcctattctaacaatccatttgct
ttactgctcagctccctgtctttaaccgctgtgcatcacggaaaaggctatgcgaaaaaa
gccatgcttttgcttcccgcttttgtgagcggatattttccatggtgcgacgaaatcatc
ttggccgtcaatcatctgaacatacgcgcaaaacacctttatatgaaaagcgggttcctt
gataaaggacggcgaagaatcgggccgcttggagaacagttgatccttcatcatttctta
tag

DBGET integrated database retrieval system