KEGG   Bacillus subtilis subsp. subtilis 168: BSU01750
Entry
BSU01750          CDS       T00010                                 

Symbol
ybbP
Name
(RefSeq) hypothetical protein
  KO
K18672  diadenylate cyclase [EC:2.7.7.85]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU01750 (ybbP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.85  diadenylate cyclase
     BSU01750 (ybbP)
SSDB
Motif
Pfam: DAC CdaA_N Haem_oxygenas_2
Other DBs
NCBI-GeneID: 938735
NCBI-ProteinID: NP_388056
Pasteur: BG11577
BSORF: BG11577
UniProt: Q45589 A0A6M3Z9Z6
Structure
PDB: 
6HUW

Position
196213..197034
AA seq 273 aa
MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIVVIVLVRMASQYLGLS
TLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTPVEEAQQKTIEAITKAI
NYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIFIPNTPLHDGAVIMKNNE
IAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVSEETGGVSVAKNGDLHREL
TEEALKEMLEAEFKKNTRDTSSNRWYWRGKKNG
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcttttgaggatatcccttttttgcagtacctcggcaatgccgttgatattctcctt
gtttggtatgtgatatataaattgattatggtgatacgcggcacgaaagcggttcagctg
ttaaaaggaattgtagtcatcgtgcttgttcgtatggccagccaatatttgggcctcagc
acacttcaatggctgatggaccaagcgataacatggggatttttagcaattattattatt
tttcagcctgagctgagaagagcgcttgaacagctaggccgcggccgctttttttcgagg
agcggcacgcctgttgaagaagcgcagcagaaaacgattgaggccattacaaaagcaatc
aattatatggcgaaacgccgtataggcgccctgctgaccattgagcgggatactggaatg
ggcgattatattgagaccggcataccactaaatgccaaagtcagctctgagctgctgatc
aatatttttattccaaacaccccgcttcatgacggtgcggtaattatgaaaaataatgaa
attgccgcggccgcctgttatctgccgctttctgagagcccgtttatttcaaaagaactg
ggcacgcggcacagagcagctgtcggtatcagtgaagtaacagacagtttgacgattatt
gtgtctgaagagaccggcggcgtcagtgtggcaaagaacggcgaccttcacagagagctt
acagaagaagcgctgaaagaaatgcttgaagccgagtttaagaaaaacaccagagacact
tcttctaaccgctggtattggaggggcaagaaaaatggataa

DBGET integrated database retrieval system