KEGG   Bacillus subtilis subsp. subtilis 168: BSU01760Help
Entry
BSU01760          CDS       T00010                                 

Gene name
ybbR
Definition
(RefSeq) YbbR-like domain-containing protein YbbR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbbR STATa_Ig
Motif
Other DBs
NCBI-GeneID: 938867
NCBI-ProteinID: NP_388057
Pasteur: BG12703
BSORF: BG12703
UniProt: O34659
Position
197027..198478
Genome map
AA seq 483 aa AA seqDB search
MDKFLNNRWAVKIIALLFALLLYVAVNSNQAPTPKKPGESFFPTSTTDEATLTDIPVKAY
YDDENYVVTGVPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHLKTGTHKVELKAKNVSD
GLTISINPSVTTVTIQERTTKSFPVEVEYYNKSKMKKGYSPEQPIVSPKNVQITGSKNVI
DNISLVKASVNLENADETIEKEAKVTVYDKDGNALPVDVEPSVIKITVPVTSPSKKVPFK
IERTGSLPDGVSIANIESSPSEVTVYGSQDVLDSLEFIDGVSLDLSKINKDSDIEADIPL
PDGVKKISPSKVTLHIEVDSEADQKFENVPIKTVGLSSSQNIEFLDPESQAIDVTAKGSP
TNINKLKKSDIELYVNVSDLEDGEHSVKLEVNGPQNVTWSLGRKNAKIKLTSKKSNTSTN
DNSSNTSGNQDTDKQTNDQKNNQQEDTKNTDKNNNDQNQDGNKDQNQDQDEDESTANSQS
SSE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggataaattcttaaacaaccgctgggctgtgaaaattattgctctgcttttcgcgctc
ttgctttatgtggcggttaacagcaaccaagcaccgactccaaaaaaaccgggtgaatct
ttctttccgacatcaacaactgatgaagcaactctgactgatattccggttaaagcgtat
tatgatgatgaaaattacgtcgtgacgggtgttccgcaaacggttaatgtcacgataaaa
ggctcgacaagcgccgtgaaaaaggctcggcagaccaaaaactttgaaatatatgccgat
atggaacatttgaaaaccggcacacataaggttgagcttaaggccaaaaacgtgtcggat
gggctgacaatctcaattaatccgtctgttacgacagtgaccattcaggaacggacgacc
aaaagttttcccgtagaagtggagtactacaacaaaagcaagatgaaaaaaggctattct
ccggagcagccgattgtcagtccgaaaaatgtgcagattaccggatcgaaaaatgtgatc
gataatatttctcttgtaaaagcttcagtgaatttggaaaacgcagatgaaacgattgaa
aaggaagcgaaagtgactgtctatgataaagacggaaacgcgcttcctgtcgacgtggag
ccctcggtcatcaagattaccgttccggtgacaagcccgagtaaaaaagtgccctttaaa
attgaacggacaggaagccttcctgacggtgtcagcatagcgaatattgaatccagcccc
agtgaggtaacggtttacggctcacaggatgtgttggattctcttgaatttattgacggc
gtcagcctagatttaagtaaaattaacaaggattccgatatcgaggcagatattccgctt
cctgacggtgtcaaaaaaatctcaccgtcaaaggtgactttgcatatagaagtcgatagt
gaagcggatcagaagttcgagaatgtccctatcaagactgtagggctgagcagctcacaa
aacattgaatttcttgatcctgaatcacaagcgatagatgtaacggctaaaggctctccc
acgaatataaataaactgaaaaaatcagatattgaattgtatgtgaatgtttcagattta
gaggacggggagcatagcgtgaagcttgaagtgaacgggccacagaatgtaacttggtcc
ttggggcggaaaaacgccaaaatcaagctgacgtctaagaaaagcaatacatcaacgaat
gataacagcagcaatacatcagggaaccaggacacagataaacaaacaaatgatcaaaag
aacaatcagcaagaagatacaaagaacactgataaaaacaacaacgatcaaaaccaagac
ggaaataaagatcaaaaccaagatcaggatgaggatgaatccactgcgaattcacaatcc
tcatcggaataa

DBGET integrated database retrieval system