KEGG   Bacillus subtilis subsp. subtilis 168: BSU01860
Entry
BSU01860          CDS       T00010                                 

Symbol
ybcF
Name
(RefSeq) carbonic anhydrase-like protein YbcF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Pro_CA
Other DBs
NCBI-GeneID: 938524
NCBI-ProteinID: NP_388067
Pasteur: BG12708
BSORF: BG12708
UniProt: O34823 A0A6M3ZA07
Position
209633..210160
AA seq 175 aa
MNVNQNKKVLFLTDIENGLEPILQEATNTSAENMLTIQSYGASISHPYGEIMRSVIFAIY
QEDVEEIFVVGTKDKKTSAGNGLTQLETMKDKIQTLDYLFQNCKPEFLGGTVDEWLNENS
SDTIEKSVDMIRHHPLVPSYVKVRGLFVNHKGGKPSIAEVPDVKTGQAMPDHCLS
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaatgtaaaccaaaataaaaaagtattatttttgacggatattgaaaacggtttggag
cctattttacaagaagcgactaacacttctgcagagaatatgttgactatacaaagctat
ggtgccagtatttcacatccttatggagaaatcatgaggtctgttatttttgcgatttac
caggaagatgttgaggagatttttgtagtaggaacaaaagataagaagacttctgcaggt
aatggactaactcaacttgaaacaatgaaagataaaatacaaacattggattatctgttt
caaaattgcaagcctgaatttttaggtggtacggtcgatgaatggctaaatgaaaatagc
agtgacaccattgaaaaaagtgttgatatgattcgacatcatcccctagtgccgtcatat
gttaaagttagaggtttattcgttaatcataagggtggaaaaccctcaatcgcggaggtt
cctgatgttaaaacaggtcaagccatgcctgatcattgcttgtcatga

DBGET integrated database retrieval system