KEGG   Bacillus subtilis subsp. subtilis 168: BSU01870
Entry
BSU01870          CDS       T00010                                 

Symbol
ybcH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF6407
Other DBs
NCBI-GeneID: 938573
NCBI-ProteinID: NP_388068
Pasteur: BG12709
BSORF: BG12709
UniProt: O34795 A0A6M4JEX9
Position
210224..210514
AA seq 96 aa
MSANLTDFVTKTIEEMNSFDRENMECIKKLIRKAIDFYHLKSYEEVEETHSGNVRFLHVH
SMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY
NT seq 291 nt   +upstreamnt  +downstreamnt
atgagcgctaatttaactgattttgtcacgaaaacaatagaggaaatgaactcgtttgat
cgtgaaaatatggaatgtataaaaaaactaattagaaaagcaattgatttttatcatcta
aagtcttatgaagaagttgaggaaacccattcaggaaatgttcgatttttgcatgtccac
tctatgatggaagaaaatatgttatccaaaatgatagtggtcacaagaaacggtaaaact
gatttggatattgaaggtgtatatgaaggatatgttgtaagagaatattaa

DBGET integrated database retrieval system