KEGG   Bacillus subtilis subsp. subtilis 168: BSU01880
Entry
BSU01880          CDS       T00010                                 

Symbol
ybcI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MpsC
Other DBs
NCBI-GeneID: 938568
NCBI-ProteinID: NP_388069
Pasteur: BG12710
BSORF: BG12710
UniProt: O34380 A0A6M4JEV9
Position
210572..210946
AA seq 124 aa
MKKSKGSIESEISKSITQWEKDYLGRGSVSVKTDILRDMIIVNLKGILTPAEYVVCGSKE
GMLSIKQTRSELVESGIEGLKDIILKITGEKVKSFHTDLSSRTGERVMVFKLCNDLEKNL
EKIL
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaaaaagtctaagggttctattgaatcagagatcagtaagtccattactcaatgggag
aaggattatcttgggcgggggtctgtatctgttaagactgatatactgcgggacatgatc
atcgtcaatttaaaagggattttaacaccagccgaatatgtagtttgtggatcaaaagag
ggtatgttatctatcaaacaaactcgttcagagttagtcgaatcaggtatagaaggcctt
aaggatattatcttaaaaataaccggagaaaaagtgaaaagttttcatactgatttaagc
tcccggacaggtgaacgagtgatggtatttaaattatgtaatgatctagagaaaaatttg
gaaaagatcttataa

DBGET integrated database retrieval system