KEGG   Bacillus subtilis subsp. subtilis 168: BSU01889
Entry
BSU01889          CDS       T00010                                 

Symbol
ybzH
Name
(RefSeq) ArsR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_20 HTH_5 MarR MarR_2 HTH_IclR DUF4423 TrmB HTH_24 Ribosomal_S25 HTH_40 HTH_45 HTH_27 Mnd1 HTH_23
Other DBs
NCBI-GeneID: 8302965
NCBI-ProteinID: YP_003097670
UniProt: C0H3S9 A0A6M3Z7E8
Position
211429..211731
AA seq 100 aa
MEPIEVFKALSNESRLQILQWLKEPDRHFAPHEGIDMNTIGVCVSQITDKLKMTQSTASQ
YLTILLRAGLIKAERIGKYTYYKRDEEAIGKLADFLKTEI
NT seq 303 nt   +upstreamnt  +downstreamnt
atggaaccaattgaagtattcaaagccttatcaaatgaatcaaggctgcaaattttacaa
tggctgaaggagcccgatcgtcattttgcaccccatgaagggattgatatgaacacaatc
ggggtatgtgtcagtcaaataacagacaaattgaaaatgacgcaatcgacagcttctcaa
tatcttaccatccttttaagagccggcctaattaaggcggagcgaatcggaaagtacacg
tattataaaagagatgaagaagccattgggaaacttgctgactttcttaaaacagagata
taa

DBGET integrated database retrieval system