KEGG   Bacillus subtilis subsp. subtilis 168: BSU01890
Entry
BSU01890          CDS       T00010                                 

Symbol
ybcL
Name
(RefSeq) MFS transporter
  KO
K08164  MFS transporter, DHA1 family, putative efflux transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU01890 (ybcL)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BSU01890 (ybcL)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 938536
NCBI-ProteinID: NP_388070
Pasteur: BG12711
BSORF: BG12711
UniProt: O34663 A0A6M3Z7D4
Position
211859..213031
AA seq 390 aa
MSNTWKIYILAIVSFLVGTSEYIISGILDQIAHTLGITLAAAGQLITIFSLVYALSTPVL
MALTASMDRRKLMMYALGLFVFGNVLAFVLPGYGWFIAARIIMAMGAGVVVVTALTIAAK
IASEGKQGSAIATVVMGFTASLIIGVPLGRMIAVALGWKSVFGAIALLGLIAMVVIFFTL
PYTEGDKPVPLLQQLALFKKRKVAMGLSITFFWLGGYSVAYTYLSPYLLNISGINGKLLS
GVLLIFGIASLVGSKFGGYSTDKWGVPFTLVGGMTLHIVTLILLSLVTHSYIGVLVILIL
WSFAAWSTGPTQQFHLATIEPEMSGVLLSMNQSMMQFAMAVGAGIGGVFVENVSLASITW
VGALGVMIAIIASLLIFNSQPKQALKDINQ
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgtctaacacttggaaaatttatattttagccattgtcagctttttagttggaacctca
gagtacatcatttccggaattttggatcaaattgctcatactctcgggatcactttagct
gccgcgggccagcttattaccattttctcacttgtatatgctctttctacacccgtactt
atggcgttgacagcaagtatggatagacgcaaattgatgatgtatgccctaggtttgttt
gtgttcggtaatgtcctggcttttgtactgcctggttatggatggtttattgcagcgcgg
atcattatggcgatgggagcaggtgtggttgttgtcaccgcattaacgattgccgctaag
attgcatcggaagggaagcagggcagtgccatcgctacggtcgtgatgggatttaccgct
tctttaatcattggtgttccgcttggaagaatgatagcagtagcattaggctggaagtct
gtatttggagccattgctttgttgggattgatcgcaatggtcgttattttctttactctt
ccgtatactgaaggggataagcctgtgcctttgcttcaacagcttgctcttttcaaaaaa
cggaaagtggctatgggattatcaatcactttcttctggctcgggggatattctgttgct
tacacttatttgtcaccgtatctcttgaacatctcaggtataaatggcaagctgctcagc
ggtgttttgcttatatttggaattgccagtttggttggatcgaagtttgggggatatagc
accgataaatggggagtgccctttacactcgttggcgggatgacgttgcatatcgtcaca
ctgattctgctgtcacttgttactcattcctatatcggagtgttggtgattctcatatta
tggtcgtttgccgcatggtccaccggtccgacacagcaatttcacctggctacaatagaa
ccggaaatgtcaggtgttttgcttagcatgaatcagtcaatgatgcaattcgccatggcg
gtcggcgcaggtataggaggggtttttgtggaaaacgtatcattggcctcgattacctgg
gttggtgcgttaggggttatgattgcaattattgcatcattgctgattttcaattcgcaa
ccgaaacaagcgctaaaagatatcaatcaataa

DBGET integrated database retrieval system