KEGG   Bacillus subtilis subsp. subtilis 168: BSU01900
Entry
BSU01900          CDS       T00010                                 

Symbol
ybcM
Name
(RefSeq) hypothetical protein
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU01900 (ybcM)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU01900 (ybcM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU01900 (ybcM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     BSU01900 (ybcM)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C44
   BSU01900 (ybcM)
SSDB
Other DBs
NCBI-GeneID: 938504
NCBI-ProteinID: NP_388071
Pasteur: BG12712
BSORF: BG12712
UniProt: O31421
Position
213155..213469
AA seq 104 aa
MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVNTCIISLKGLDNADDR
FVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE
NT seq 315 nt   +upstreamnt  +downstreamnt
atgagatttcttaaggctttgccgcggcgagctgaagtacagtacgattgccttgatcga
acactggaaacacaagagaacgtaaacctgaacatccgcgtaaacgtcaaggaagttgcc
acttggggagtaaacacttgcatcatctcgctgaaaggcctagacaatgcggatgacaga
ttcgtattgccggaagtaaacacagcgcttgctctgtttccgttgtcgattgcagctgat
tgcttactaatgctgccctgcatctcggttgtgatgtcgataagcagcgtaatgaagagt
gttactgtggagtaa

DBGET integrated database retrieval system